KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0314Help
Entry
BSSP1_I0314       CDS       T03367                                 

Gene name
bcsA
Definition
(GenBank) Glycosyl transferase, group 2 family protein, a member of the cellulose synthase superfamily
Organism
bsui  Brucella suis bv. 2 Bs143CITA
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 SpoU_sub_bind SUD-M
Motif
Other DBs
NCBI-ProteinID: AIB27183
LinkDB All DBs
Position
I:320537..322357
Genome map
AA seq 606 aa AA seqDB search
MPQDRIENAFSAAHLHGTGFFEEAVHQPGVTERMVYEAIADYLQLPYTEEILPSRIFVSG
DENICFAHIRQVMVIGRDGISYLYIAPGERRIARLREHLKAAPQLRERIRICTPSVLKSI
LRQRHQRDLVMRAHAMTPQLFSAARVLDTPQAFVIAMAVYAFLGCIVNWPMKTMLALHVA
MSLFFFGCVLIRLFAAASGKRLQFTEIAPFKPRDLPVYSILVPLYREKDVVAQLIAALNR
LNWPRSKLDIKLVCEKDDYETIAAIRCNTMPSNFELVLVPPGGPRTKPKALNYALQFARG
EIVAVFDAEDRPHPDQLLEAWQAFRRGGSKLACVQAPLIIGNFRRNLLTRMFAFEYAVLF
RGLLPWLARRGLVIPLGGTSNHFRRSCLEQVGGWDAYNVTEDADLGMRLARFGYRIDVIS
RGTIEDAPEEHGVWHRQRTRWIKGWMQTWLVHGRQPMSTWRELGWWRFVVSQIYTLGIIG
SALLHPLMLLMLAGLCLRMAFGPLTPQGLWLLALDVINILMAYMSFHMLGAKTMEPTELG
GYAYFLAIPIYWVLISLSAWRAVWQLVRQPHLWEKTPHQPNLFYIPLEDASSEFDARNAA
PRPIMD
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggacagaattgaaaatgcattcagtgctgcacatctccacggcaccggcttt
tttgaagaggcggttcatcagcccggcgtgacggagcgcatggtttatgaggcgatcgcg
gattatctccagcttccctatacggaagagatcctgccttcgcgcattttcgtttccggt
gatgaaaatatctgttttgcccatatccggcaggtgatggtcatcggccgcgacggcatc
tcctatctttatatcgcgccgggcgaacggcgcatcgcgcggctgcgcgaacatctgaaa
gccgcgccgcaattgcgcgagcgcattcgcatctgcacgccatcggttttgaaaagcata
ttgagacagcgtcatcagcgcgacctcgtgatgcgggcccacgccatgacgccgcaattg
ttctccgccgcacgtgtgcttgatacgccgcaggcttttgtcatcgccatggcggtctac
gcatttctggggtgtattgtgaactggccgatgaaaaccatgctggcgctgcatgttgcc
atgtcgctgtttttcttcggctgtgttcttatccgcctttttgccgccgcttctggcaag
cggctgcaattcacggaaattgcgcctttcaagccgcgtgatctgccggtctattctata
ttggtgccgctctatcgcgaaaaggacgtggttgcgcagcttatagcagcactcaaccgg
ctcaattggccacgcagcaagctcgacatcaagcttgtctgcgagaaggacgattacgag
accattgccgcgatcaggtgcaacactatgccgtccaatttcgagctggtccttgtgccg
cccggcggtccgcgcaccaagcccaaggcgctgaattatgcgctgcaatttgcccgtggc
gagattgtcgccgttttcgatgccgaggatcggccgcatcccgaccaattgctggaggct
tggcaggccttccggcggggcggcagcaagcttgcctgtgtgcaggcgccgctcattatc
ggtaacttccggcgcaacctgctcacccgcatgtttgcctttgaatatgcggtgctgttt
cgcggccttctgccatggcttgccaggcgcgggctggttattccgcttggcggaacatcc
aatcactttcgccgctcctgtctggaacaggtgggcggatgggatgcctataatgtcacc
gaggatgccgatctcggcatgcggttggcgcggtttggctatcgcatcgatgtcatcagc
cgcggcacgatagaggatgcgccggaagaacacggggtctggcacaggcagcgcacgcgc
tggatcaaggggtggatgcagacatggctggtgcatggccgccagccgatgagcacctgg
cgcgagcttggctggtggcgtttcgtcgtgagccagatttatacgctcggcatcatcggt
tcggcgctgctgcacccgctgatgctgctcatgctggcagggctttgcctgcgcatggcg
ttcgggccgctgacaccgcagggcctgtggcttctggcgctcgatgtcatcaatatcctg
atggcttatatgagcttccatatgctcggcgccaagaccatggagccgacggaacttggc
ggctatgcctatttccttgccattcccatctactgggtgctgatctcgctttcggcatgg
cgggctgtgtggcagctggtgcgccagcctcatctctgggaaaagaccccgcaccagcca
aacctgttctacattccgctggaggatgcctcttctgaattcgacgcgaggaatgccgcc
ccgcgcccgataatggattga

DBGET integrated database retrieval system