KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0390Help
Entry
BSSP1_I0390       CDS       T03367                                 

Definition
(GenBank) Putative membrane protein YfcA
  KO
K07090  uncharacterized protein
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSSP1_I0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AIB27259
LinkDB All DBs
Position
I:complement(399511..400296)
Genome map
AA seq 261 aa AA seqDB search
MSEFFDSLTLLLTAAAFIAGIIDSIAGGGGMITIPALLLAGIPPVEALGTNKLQGLFGSS
SATIAYARKGHVNILQQWPEALASLLGSVLGALLATVLPVNIMRAALPMLLIAIAIYFAL
KPSLGDVDRARRIGPFLFGVTLVPLIGFYDGLFGPGTGSFFMLAFVAFAGYGVLKATAHT
KLLNCASNIGGLATFAAVGVINWKIGISMGIAQFIGAQIGARLAMKIGSRIIKPLLIVVS
LALAGRLLMDGTSPLRQWLGI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatttttcgattcgcttaccctgctcctgacggctgccgctttcattgccggc
attatcgattccatcgccggtggcggcggcatgattaccattccggccctgcttctggct
ggtatcccgcctgtcgaggcgctcggcacgaacaagctgcaaggactgttcggctcatcc
tccgcaaccatcgcctatgcgcgcaaggggcatgtgaatattctccagcaatggcccgag
gctcttgcctcgctccttggctccgtgctgggcgcacttcttgcaaccgtgcttcccgtc
aacatcatgcgcgcggcgctgccgatgctgctgattgcaattgcgatctacttcgccctc
aagccaagccttggcgacgtcgatcgcgcgcggcgcatcggtccatttctgttcggtgtg
acgctggtgccgctgatcggcttttatgacgggcttttcgggccgggcaccggctcgttc
ttcatgctggctttcgtggcgtttgcaggctacggcgtgttgaaagccaccgcgcacacc
aagcttctcaattgcgcctcgaatatcggcggtttagccacttttgccgcggtcggtgtc
atcaattggaaaatcggcatctcaatggggattgcacagttcatcggcgcgcagatcggc
gcacgcctcgccatgaagatcggttcacgcatcatcaagccgctattgatcgtggtcagc
ctcgcgctggcagggcgccttctgatggacggcaccagtccgctgcgccagtggttaggc
atctaa

DBGET integrated database retrieval system