KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0446Help
Entry
BSSP1_I0446       CDS       T03367                                 

Gene name
tuf
Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsui03012]
    BSSP1_I0446 (tuf)
   03029 Mitochondrial biogenesis [BR:bsui03029]
    BSSP1_I0446 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsui04147]
    BSSP1_I0446 (tuf)
Translation factors [BR:bsui03012]
 Eukaryotic Type
  Elongation factors
   BSSP1_I0446 (tuf)
 Prokaryotic Type
   BSSP1_I0446 (tuf)
Mitochondrial biogenesis [BR:bsui03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSSP1_I0446 (tuf)
Exosome [BR:bsui04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSSP1_I0446 (tuf)
  Exosomal proteins of breast cancer cells
   BSSP1_I0446 (tuf)
  Exosomal proteins of colorectal cancer cells
   BSSP1_I0446 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIB27312
LinkDB All DBs
Position
I:442520..443695
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPIIKGSAIAALEDSSKE
LGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgaacgtacgaagccccacgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtttttcggcgaattcaag
gcgtatgaccagatcgacgccgcgcctgaagaacgcgcccgcggcatcacgatctcgacg
gcccacgtcgagtacgagaccgcaaaccgtcactatgcacacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggcgctgcccagatggatggcgcgatcctggtg
gtttcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggcgatcgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagtgcgcgaacttctgtcgaagtacgaattccccggc
gacgaaatcccgatcatcaagggctcggctattgctgctctggaagattcttccaaggaa
ctgggcgaagatgccatccgcaacctgatggacgcggttgacagctacattccgaccccg
gaacgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagtt
gaaatcgtcggcatcaaggcgacgacgaagaccacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacattggcgcgctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagtttaaggcagaagcctatattctgaccaaggacgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgtacgacggacgtgacgggtgttgtgacg
cttccggctggcacggaaatggtcatgcctggcgataacgtcgccatggacgttaccctg
atcgtgccgatcgccatggaagagaagcttcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtctcgtcgatcatcgagtaa

DBGET integrated database retrieval system