KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0499Help
Entry
BSSP1_I0499       CDS       T03367                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00730  Thiamine metabolism
bsui00790  Folate biosynthesis
bsui01100  Metabolic pathways
bsui02020  Two-component system
Module
bsui_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSSP1_I0499
   00790 Folate biosynthesis
    BSSP1_I0499
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSSP1_I0499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsui04147]
    BSSP1_I0499
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsui00537]
    BSSP1_I0499
Enzymes [BR:bsui01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSSP1_I0499
Exosome [BR:bsui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSSP1_I0499
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsui00537]
 Enzymes
  BSSP1_I0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AIB27364
LinkDB All DBs
Position
I:complement(485486..486853)
Genome map
AA seq 455 aa AA seqDB search
MAQSETAAPLFQRSAKGDLSAAGGARRLDGDITAAFRDQIRKGPARNVILLIGDGMGDSE
ITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDKESGKPNYVTDSAASGTAWATGVKTYN
GAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAELQDATPAVQVAHVTHRKCYDPTSTAEK
CKDNALENGGPGSISEQLLNTRPDVTLGGGAKYFEDKARAGTWKGQTLSAQAEARGYQLV
RNADALSKVETANQDKPVLGLFSPGNMPVRWKGPQAAHHGNLDREPVKCKVNEKRTADIP
TLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQAALDFAR
KDGNTLVIVTADHAHASQIIDPDAKAPGLSQALKTEDGAIMGVTYGNSDEADDQGHTGAQ
LRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtctgaaactgcggctccactcttccagcgcagcgcaaaaggcgacctgtcg
gcagcaggcggcgcacgccgccttgatggtgatattaccgcagcttttcgcgatcagatc
aggaaggggcctgccagaaacgtcatcctgctgatcggagacggcatgggcgattccgag
atcacggttgcgcgcaattatgcagtcggcgcaggcaatcatttcaagggcatcgatgcc
cttcccgttaccggccagtacacccattattcgctcgacaaggaaagcggcaagccgaat
tacgtgactgattctgccgcctccggcaccgcctgggccactggcgtcaaaacctataac
ggcgccatcggcgtcgatattcatggcaaaccgcacaaaacgctcattgaactcgccaag
gaaaagggcctcggcaccggcaatgtcagcactgccgaattgcaggatgccacacccgcc
gtgcaggttgcccatgttacccatcgcaagtgctacgacccaaccagcacggcggaaaag
tgcaaggataatgcgcttgaaaatggcggcccaggctcgatcagcgaacagcttttgaac
acccgcccggacgtgacattgggcggcggcgcaaaatatttcgaggacaaggcccgggct
ggcacatggaaaggccagaccttgagcgcacaggccgaagcacgcggctatcaactggtt
agaaatgccgacgcattgagcaaggtcgagacagccaatcaggacaaacctgttctcggc
ctcttctcaccgggcaacatgccggtccgctggaaagggcctcaggccgcccatcacggc
aatctcgacagagagcctgtcaagtgcaaggtcaatgagaagcgcactgccgatattccg
acactggcgcaaatgaccgagaaagccatcgacctgctgaaaaccaacgaaaaaggcttt
ttccttcaggtggaaggtgcctccatcgacaaacaggaccatgccgccaatccgtgcggg
cagatcggcgaaacagtcgatctggatgaagccgtgcaggccgcactcgattttgcccgc
aaagacggcaacacgcttgtcatcgtaacggccgatcacgcccatgcaagccagatcatt
gatcccgatgcgaaggctccgggtttgagccaggcattgaaaaccgaggatggcgcgatc
atgggcgtgacctatggcaattccgacgaagccgacgatcagggccacacaggcgcgcaa
ttgcgcatagccgcctttggccccggcgctgccaattttaccggcctcacggatcagacg
gatatgttctacacgatccgcgatgccttgcagttgcaggcggaataa

DBGET integrated database retrieval system