KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I1446Help
Entry
BSSP1_I1446       CDS       T03367                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00473  D-Alanine metabolism
bsui00550  Peptidoglycan biosynthesis
bsui01100  Metabolic pathways
bsui01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSSP1_I1446
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSSP1_I1446
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSSP1_I1446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsui01011]
    BSSP1_I1446
Enzymes [BR:bsui01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSSP1_I1446
Peptidoglycan biosynthesis and degradation proteins [BR:bsui01011]
 Precursor biosynthesis
  Amino acid ligase
   BSSP1_I1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIB28295
LinkDB All DBs
Position
I:complement(1400491..1401417)
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERSVSLSSGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVVVAPSRLMNR
FDIGSQHPMKPPYVVKPVREGSSFGVVIVKEDQPHPPQVIGSADWKYGDEVMVEGYIAGR
ELTCAVMGDRAMDVCEIIPVGYQFYDYDSKYVAGASTHVSPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSEEGEVVWLEINTQPGMTPTSLVPDIAKAAGISFAELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaacacgtcgccgttttgatgggtggtttttcttcggaacgctccgtcagc
ctttcctccggtgtggcctgtgcaacgacgcttgaagaatgcggctatcgcgtcacgcgc
attgatgtggatcgcaatgttgcgagcatcctggtcgagttgaaacccgatgttgtgttc
aacgccttgcacggccccttcggcgaagatggcgccattcagggcgtgcttgaatatctc
cagattccctacacacattccggcgtgctggcttccgcgcttgcgatggacaaggatcgc
gccaagaaggtggcggcagcggcgggcgtcgtggttgcgccgtcacgcctgatgaaccgt
ttcgacattggttcgcagcatccgatgaagccgccttacgtggtgaagccggtgcgtgaa
gggtcgagcttcggtgtggtgatcgtcaaggaagatcagccgcatccgccgcaggtcatc
ggttcggccgattggaaatatggtgatgaggtcatggtcgaaggctatattgccgggcgt
gagctgacctgtgccgtgatgggggatcgcgccatggatgtgtgcgagatcattccggtc
ggttatcagttctacgactatgattcaaaatatgttgcaggtgcatcaactcacgtgtcc
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagtcggtcggacttccgtttcgatgatcgtttttct
gaagaaggcgaagttgtctggctggaaatcaatacccagccggggatgactcctacctcg
ctcgtgcctgatatcgccaaagcggcgggtatctctttcgctgagttgttgagttggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system