KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I1702Help
Entry
BSSP1_I1702       CDS       T03367                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00020  Citrate cycle (TCA cycle)
bsui00190  Oxidative phosphorylation
bsui00650  Butanoate metabolism
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01120  Microbial metabolism in diverse environments
bsui01130  Biosynthesis of antibiotics
bsui01200  Carbon metabolism
Module
bsui_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsui_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsui_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSSP1_I1702
   00650 Butanoate metabolism
    BSSP1_I1702
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSSP1_I1702
Enzymes [BR:bsui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSSP1_I1702
    1.3.5.4  fumarate reductase (quinol)
     BSSP1_I1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AIB28541
LinkDB All DBs
Position
I:complement(1647203..1647982)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQKEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDSYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgatatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagaaggaatggctgcaaagccatgaggac
cgccagaagctcgatggtctttatgagtgcattctgtgcgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgacagttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgagcgccgcgtgtaa

DBGET integrated database retrieval system