KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I1828Help
Entry
BSSP1_I1828       CDS       T03367                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01130  Biosynthesis of antibiotics
bsui01230  Biosynthesis of amino acids
Module
bsui_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSSP1_I1828
Enzymes [BR:bsui01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSSP1_I1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 RsgA_GTPase AAA_30 TsaE AAA_22 AAA APS_kinase 6PF2K AAA_17 SRP54 AAA_5 DUF815 ABC_tran AAA_16
Motif
Other DBs
NCBI-ProteinID: AIB28665
LinkDB All DBs
Position
I:complement(1766119..1766721)
Genome map
AA seq 200 aa AA seqDB search
MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIET
VSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISI
WINADLDVLMERVSRRQNRPLLRNSDPRGVMQRLMDERYPVYALAELHLMTRDEKKEVIA
AELIEVLAAHLEKEQAASAG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtacgaacaaacaaacaaatcttcacaggcagacggaaacgatccgccagctg
ctcggcagtaaagtggttgttctcgttggcctgatgggagccggaaaatccaccatcggc
cgcaaggtggcgaacatgctcaacctgccgttcaaggatgcggatacggaaattgaaact
gtttcgcggatgactgttgccgaactgttcgaggcctatggggaagtggaatttcgcgat
ctcgaacgtcgcgtgatcctgcgccttctcgatgacggccccatggtgctggcgaccggc
ggcggcgcctatatgaacgccgaaacccgcgcggcgattgccgaagcggggatttccatc
tggattaatgccgatctcgacgtcttgatggagcgcgtttcgcgccgccagaaccgtccc
cttttgagaaacagcgatccgcgcggcgtcatgcagcggctgatggacgagcgctacccg
gtttatgcgctggccgagctgcatctgatgacgcgcgatgagaaaaaggaagtgattgcc
gcagaactgatcgaggttctggcggcgcatctggaaaaggaacaggccgcttccgccgga
tga

DBGET integrated database retrieval system