KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_00499Help
Entry
BSUA_00499        CDS       T03443                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00473  D-Alanine metabolism
bsul00550  Peptidoglycan biosynthesis
bsul01100  Metabolic pathways
bsul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSUA_00499 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSUA_00499 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSUA_00499 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsul01011]
    BSUA_00499 (ddl)
Enzymes [BR:bsul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSUA_00499 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bsul01011]
 Precursor biosynthesis
  Amino acid ligase
   BSUA_00499 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIC38826
LinkDB All DBs
Position
491773..492858
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEKGEWVRGARLTEPVSN
VKMLQFEQGGSAFSPAALNQEMFPQEASQQNEAIDVVFPLLHGPNGEDGTIQGMLELLNI
PYVGNGVLASSAGMDKVVMKHLFAQVGLAQAKYAAFLKKDWTRSPKESCEEVEQELGYPC
FVKPANLGSSVGISKCRNREELQKAFELAFQYDRKVVVEEGINGREIEIGVLGNDDPKCS
VVGEIAPKTDFYDYKAKYEDGDTDLMIPAIVTDEEYATISDMAIKAFKAIDGSGLVRADF
FLTADGEVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattagtgtacggaggaaagtcggcagaacataatgtttccctg
cagacagctctggctgtaatcaaagcgctaaatactgagaagtttgatatacatccgatt
tatataacagaaaaaggcgaatgggttagaggcgcccgtttaactgaacctgtttcaaac
gtgaaaatgcttcaatttgagcaaggaggcagtgctttttctccagctgccctgaaccag
gagatgtttccgcaggaagcgtcacagcaaaatgaagccatcgacgtcgtattcccgctc
ctccacggaccgaacggagaagacggtacgatccagggaatgctcgagctgttgaacatt
ccttatgtcggcaacggagtgcttgcttcctcagctggcatggataaagttgtcatgaaa
catttatttgcgcaggttggccttgctcaggctaaatacgcagctttccttaagaaagac
tggactcgttctccgaaagaaagctgtgaggaggttgaacaggaattaggctacccttgc
ttcgtaaaaccggcgaacctcggctcaagtgtcggaatcagcaaatgccgaaaccgtgaa
gaactgcaaaaagcgtttgagcttgctttccaatatgaccgcaaagtcgtcgttgaagaa
ggaattaacggccgcgagatcgaaatcggcgttcttggaaatgatgatcctaaatgctct
gttgtgggagaaatcgcaccgaagacagatttctacgattacaaagcgaaatatgaggat
ggagatactgatctgatgattccggcgattgtgactgatgaggaatacgcaacaatcagt
gatatggcgatcaaagcgtttaaagcgatcgacggttcaggactcgtcagagcggacttt
ttcctgacagctgacggcgaagttctgatcaatgaagtcaacacaatgcctggctttaca
cctttcagcatgttcccgttgctctggaaagaagccggagtggaatatgctgacctgatt
gaacagcttgtggagcttgcaaaagaacgccacgctgaaaaacaattgattaagcataca
ttctaa

DBGET integrated database retrieval system