KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_00507Help
Entry
BSUA_00507        CDS       T03443                                 

Gene name
alrA
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00473  D-Alanine metabolism
bsul01100  Metabolic pathways
bsul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSUA_00507 (alrA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSUA_00507 (alrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsul01011]
    BSUA_00507 (alrA)
Enzymes [BR:bsul01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSUA_00507 (alrA)
Peptidoglycan biosynthesis and degradation proteins [BR:bsul01011]
 Precursor biosynthesis
  Racemase
   BSUA_00507 (alrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIC38834
LinkDB All DBs
Position
500918..502087
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADMSDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNISN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagagatacgtgggcggaaattgacttgtccgcgataaag
gaaaatgtcagcaatatgaaaaaacatatcggtgaacatgtccacttgatggcagttgtg
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgacgcaggt
gcttcatgcttggccgtggccattttggatgaagcgatttcactgcgcaaaaagggattg
aaggcgcctatattggtgcttggcgcggttcccccggagtatgtggcaatcgctgctgag
tatgacgtgaccttaacaggttattctgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacagacttggtgta
aaaacagaggaagaagttcagaacgtgatggcaattcttgaccgcaaccctcgtttaaag
tgcaaaggggtatttacccattttgcgacagcggatgaaaaagaaagaggctatttctta
atgcagtttgagcgctttaaagagctgattgctccgctgccgttaaagaatctaatggtc
cactgcgcgaacagcgccgctggactccggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatgtcggacgagataccgttt
cagctgcgtccggcatttaccctgcattcgacactgtcacatgtcaaactgatcagaaaa
ggcgagagcgtcagctacggagccgagtacacagcggaaaaagacacatggatcgggacg
gtgcctgtaggctatgcggacggctggctccgaaaattgaaagggaccgacatccttgtg
aagggaaaacgcctgaaaattgccggccgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagtcacattaataggccggcagggggatgaatat
atttccatggatgagattgcaggaaggctcgaaaccattaactatgaggtggcctgtaca
ataagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggtaaatataagcaattaa

DBGET integrated database retrieval system