KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_00682Help
Entry
BSUA_00682        CDS       T03443                                 

Gene name
gutB
Definition
(GenBank) glucitol (sorbitol) dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00040  Pentose and glucuronate interconversions
bsul00051  Fructose and mannose metabolism
bsul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUA_00682 (gutB)
   00051 Fructose and mannose metabolism
    BSUA_00682 (gutB)
Enzymes [BR:bsul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BSUA_00682 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIC38993
LinkDB All DBs
Position
651014..652075
Genome map
AA seq 353 aa AA seqDB search
MTHTVPQNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNY
VVEKPFILGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFL
ATPPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMG
MGPVGLMAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDR
GVDVAWETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYA
NTYPKGIEFLASGIVDTKHLVTDQYSLEQTQDAMERALQFKNECLKVMVYPNR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactcacacagtacctcaaaacatgaaagcggctgttatgcacaacacaagagagatc
aaaattgaaacattgcctgtgcctgatatcaatcatgatgaagtgttgattaaggtgatg
gctgtcggaatttgcggatctgatctgcattactatacaaatggccgaataggcaactat
gttgtggaaaaaccatttatccttgggcatgaatgtgcgggtgaaattgccgctgtcgga
tcatctgtcgatcaattcaaggtgggagaccgcgtcgctgtagagccgggtgttacgtgc
ggacgctgtgaggcgtgcaaagaaggacgctataatctttgcccggatgtacagtttttg
gctacaccgccggtagacggtgcgtttgtccaatatattaaaatgcgtcaggactttgtt
tttttaatcccagactcactttcttatgaagaagctgctttgatcgagccgttttctgtc
ggtatccatgcggcggccagaacgaagctacagcccggatcaacgattgcgattatgggg
atgggccctgttgggttaatggctgttgccgcagctaaagcatttggggcaggcacaatc
attgtcaccgacttagagccgctgcggttagaagctgcgaaaaaaatgggagcgactcac
attattaatatacgtgaacaggatgcacttgaagagattaaaacgatcacgaatgataga
ggcgttgatgttgcttgggaaacagcagggaatccagcggcattgcaatccgcactggct
tctgtgcgccggggcggaaaattggcgattgtcggtttgccttcacagaacgagattccg
ctcaacgtgccgtttattgcggataatgagattgatatttacgggatcttccgttatgcc
aatacgtatccaaagggaatcgaatttcttgcttcaggcattgtggacacgaagcatcta
gtaacggaccaatattcgctggagcagacgcaagatgcgatggagcgggcgcttcaattt
aagaatgaatgtttaaaagtgatggtgtatccaaatcgctga

DBGET integrated database retrieval system