KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_00739
Entry
BSUA_00739        CDS       T03443                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00970  Aminoacyl-tRNA biosynthesis
bsul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSUA_00739 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_00739 (gatA)
Enzymes [BR:bsul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BSUA_00739 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BSUA_00739 (gatA)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_00739 (gatA)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AIC39050
LinkDB
Position
712586..714043
AA seq 485 aa
MSLFDHKITELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDE
AVDGRSEHGLLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIG
KLNMDEFAMGSSTENSAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIR
QPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDKMDSTS
ANVDVPDFLSSLTGDIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVSLP
HSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDPLT
MYANDILTIPVNLAGVPGISVPCGLADGLPLGLQIIGKHFDESTVYRVAHAFEQATDHHK
AKPEL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcattatttgatcataaaatcacagaattaaaacagctcatacataaaaaagagatt
aagatttctgatctggttgatgaatcttataaacgcatccaagcggttgatgataaggta
caagcctttttggcattagatgaagaaagagcgcgcgcatacgcgaaggagcttgatgag
gcggttgacggccgttctgagcacggtcttcttttcggtatgccgatcggcgtaaaagat
aatatcgtaacaaaagggctgcgcacaacatgctccagcaaaattctcgaaaactttgat
ccgatttacgatgctactgtcgttcagcgccttcaagacgctgaagcggtcacaatcgga
aaactgaacatggacgaattcgccatggggtcatctacagaaaactcagcttacaagctg
acgaaaaacccttggaacctggatacagttcccggcggttcaagcggcggatctgcagct
gcggttgctgcgggagaagttccgttttctcttggatctgacacaggcggctccatccgt
cagccggcatctttctgcggcgttgtcggattaaaacctacatacggacgtgtatctcgt
tacggcctggtcgcatttgcgtcttcattggaccaaatcggaccgattacacgtacggtt
gaggataacgcgtttttacttcaagcgatttccggcgtagacaaaatggactctacgagt
gcaaatgtggacgtgcctgattttctttcttcattaactggcgacatcaaaggactgaaa
atcgccgttccgaaagaataccttggtgaaggtgtcggcaaagaagcgagagaatctgtc
ttggcagcgctgaaagtccttgaaggtctcggcgctacatgggaagaagtgtctcttccg
cacagtaaatacgcgcttgcgacatattacctgctgtcatcttctgaagcgtcagcgaac
cttgcacgctttgacggcatccgctacggctaccgcacagacaacgcggataacctgatc
gacctttacaagcaaacgcgcgctgaaggtttcggaaatgaagtcaaacgccgcatcatg
ctcggaacgtttgctttaagctcaggctactacgatgcgtactacaaaaaagcgcaaaaa
gtgcgtacgttgattaagaaggatttcgaggacgtatttgaaaaatatgatgttattgtt
ggaccgactacaccgacacctgcgtttaaaatcggtgaaaacacgaaggatccgctcaca
atgtacgcaaacgatatcttaacgattccggtcaaccttgccggcgtaccgggaatcagt
gtgccatgcggattagcagacggacttccgctcggcctgcaaatcatcggaaaacacttt
gatgaaagcactgtataccgcgttgctcatgcatttgaacaagcaacagaccatcataaa
gcaaaacctgaactgtaa

DBGET integrated database retrieval system