KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_01000
Entry
BSUA_01000        CDS       T03443                                 

Symbol
yhcD
Name
(GenBank) hypothetical protein
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
SSDB
Other DBs
NCBI-ProteinID: AIC39289
LinkDB
Position
963861..964016
AA seq 51 aa
MKKANPFTHAGLPFLLFPSIMFLSNKSMEYVVFHLDLVYYVTHTPRIFSGR
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaaaaaggcaaatccgtttactcatgcgggtttgccttttttgctgtttccatcaatt
atgtttttatcaaataaatccatggaatatgttgtattccaccttgatctagtgtactat
gttactcatacaccgaggattttttccgggaggtaa

DBGET integrated database retrieval system