KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_01023Help
Entry
BSUA_01023        CDS       T03443                                 

Gene name
glpF
Definition
(GenBank) glycerol permease
  KO
K02440  glycerol uptake facilitator protein
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsul02000]
    BSUA_01023 (glpF)
Transporters [BR:bsul02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    BSUA_01023 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AIC39312
LinkDB All DBs
Position
986049..986873
Genome map
AA seq 274 aa AA seqDB search
MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISG
AHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGV
FSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEGLNPLIVGFLIVAIGISLGGTT
GYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFYNAAFKGHITS
SFWIVSVILVVVLLGLYVYTKSHSAKTLSNSKYI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattttggggagaagtcatcggtacgatgctgcttatcatttttggtgcaggt
gtttgtgcaggtgtcaatttaaagaaatcgctttcattccagtctggctggattgttgtt
gtatttggatggggattgggtgttgccatggcggcatacgcggttggcggcatcagcggt
gcccatttgaatccggcgctaacgatagcgcttgcatttgtaggagattttccttggaaa
gaggttccggtttatattgcggcgcaaatgatcggagcgatcatcggtgcggtgattatt
tatctgcattacctcccgcactggaagtcaacggatgatcccgctgccaagctgggtgtt
ttctcaacagggcccagcattccgcatacatttgcaaacgttttaagcgaagtgattggg
acatttgtccttgtacttggaatcttggccataggtgcaaatcaatttacagaaggactt
aatcctttaatcgtcggtttcctcattgtagcaatcggtatttctctgggaggcaccacc
ggctatgctatcaatcctgcacgtgacttaggtccgcggatcgcccacgcttttcttccg
attccggggaagggctcatcaaactggaaatacgcatgggttccggtagtcggcccgatt
ttaggcggatcattcggcggtgtattttacaacgctgcatttaaagggcacatcacaagc
agcttctggattgtaagcgttatattggttgtggtattgttaggactctatgtttatacg
aaatcacattctgctaaaacattatcaaattctaaatatatttaa

DBGET integrated database retrieval system