KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_01638
Entry
BSUA_01638        CDS       T03443                                 

Gene name
rpmF
Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSUA_01638 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsul03011]
    BSUA_01638 (rpmF)
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_01638 (rpmF)
Ribosome [BR:bsul03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSUA_01638 (rpmF)
  Bacteria
    BSUA_01638 (rpmF)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_01638 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p zf-ribbon_3 DZR HypA zinc_ribbon_2 Zn-ribbon_8 GATA zf-ACC zn-ribbon_14
Other DBs
NCBI-ProteinID: AIC39924
LinkDB
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
1559355..1559534
AA seq 59 aa
MAVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNGKDINVKSN
NT seq 180 nt   +upstreamnt  +downstreamnt
atggctgtaccttttagaagaacttctaaaatgaagaaaagattgcgccgtacacatttc
aaacttaatgtacctggtatgacagaatgtccgtcatgcggagagatgaagttgtctcac
cgtgtatgcaaagcatgcggatcatacaacggcaaagacataaatgtaaaaagtaactaa

DBGET integrated database retrieval system