KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_01730
Entry
BSUA_01730        CDS       T03443                                 

Gene name
rpsP
Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSUA_01730 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsul03011]
    BSUA_01730 (rpsP)
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_01730 (rpsP)
Ribosome [BR:bsul03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSUA_01730 (rpsP)
  Bacteria
    BSUA_01730 (rpsP)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_01730 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: AIC40016
LinkDB
Position
1657171..1657443
AA seq 90 aa
MAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWL
QTGAKPSDTVRNLFSSQGIMEKFHNAKQGK
NT seq 273 nt   +upstreamnt  +downstreamnt
atggcagtaaaaattcgtttaaaacgtatgggagcaaaaaaatctcctttctatcgtatt
gttgtagcagattctcgttcaccacgtgacggccgtttcatcgaaacagtcggaacttac
aacccggttgcaaaaccagcggaagtaaaaattgacgaagagcttgctcttaaatggctt
caaactggagcgaaaccatctgatacagttcgcaacttgttctctagccaaggaatcatg
gaaaaattccacaacgctaaacaaggcaagtaa

DBGET integrated database retrieval system