KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02084Help
Entry
BSUA_02084        CDS       T03443                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00020  Citrate cycle (TCA cycle)
bsul00310  Lysine degradation
bsul00380  Tryptophan metabolism
bsul01100  Metabolic pathways
bsul01110  Biosynthesis of secondary metabolites
bsul01120  Microbial metabolism in diverse environments
bsul01130  Biosynthesis of antibiotics
bsul01200  Carbon metabolism
Module
bsul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUA_02084 (odhA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSUA_02084 (odhA)
   00380 Tryptophan metabolism
    BSUA_02084 (odhA)
Enzymes [BR:bsul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSUA_02084 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Amidinotransf
Motif
Other DBs
NCBI-ProteinID: AIC40367
LinkDB All DBs
Position
complement(2081542..2084376)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSDIKEASG
TKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDEKKSELFPLSDYGLTEEEI
KAIPASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGELF
QKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQSGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVPSKKEHTACEIELPE
PVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHN
SPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFQPVYEQSGLSHDYEKVTRLVLSSGKVSIDISDHF
NKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWGYISPYLT
EIAPEGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaacgaatgaattgggaagatttttacggtccgaacctc
ggctatgcgctggagctttacgatcagtatacccaggatccgaacagcattgacccggat
ttgaaggaaatgttcgacgagctcggtgctccgccaagcgatataaaagaggcctcggga
acaaaagaaaagggacgtgttacagccgatctgattcaaaagatcgcatccgcagtcaga
cttgcagaagatatccgaacctatggccatttgaacgcttccgtcaatccgctcagaaag
gatgagaaaaagagcgaactttttccattatccgattacgggctaacagaagaggaaata
aaagcaatacctgcgtctgtcatctgcaaagacgctcctaaaaacatttcgaacggttta
gaagccattcagtatttacgaaatacgtataaaagaaccatctcttttgaatttgaccat
gtgcatgacttcaaagagcgcgagtggctgacaagaaagattgaatctggcgagctgttc
cagaagaactcagctgaaaagctgtcagctgtgctggaaagattgacagaagtagagggc
tttgagcagtttttgcaccgcacattcgtcgggcagaagcgcttttccattgagggtctg
gacgctcttgttccagtgcttgatgacattattgcacaatctgtcaaatcaggcacgaca
agtgtcaacatcgggatggcgcacaggggacgcctgaatgtcttggcacatgtgctcggc
aaaccgtatgaaatcatcttctctgaattccagcatgcgccgaacaaagatcttgtaccg
tctgagggatccattggaatcagctacggatggacgggggatgtcaaataccatttgggg
gcgaatcgggagcttcaagacgctgaaacaaaatcagcgcgcattacgttagcgaacaac
ccgagccacttggaatttatcaatccgattgttgaaggcagcacaagagcggcacaggaa
acgcgaacacaaagcggatacccggtacaagatgaaacaaaatcgctggccattttaatc
catggagacgctgcattccctggggaaggaattgtagctgaaacattgaatttaagctct
ttaaaagggtatcaagtaggcggtgcgattcatattatcgccaataacatgatcggattc
acaacagaaagcgctgaatccagatcgacaaaatatgccagcgacctggccaagggttat
gaaattccgattgttcacgtgaatgcggacgatcctgaagcttgtctttcagctgttaag
tttgcggtcgaataccgaaaaacattcaacaaggattttctgattgatttgatcgggtac
agacgctatggacacaacgaaatggatgaaccgtcaaccactcagccaatgctgtatgat
gctgtcagaaagcatccgaccgtcaaacaaattttcgctgaaaagctggtaaaagaaggc
gtggttaccgaggaagtcgttcaaaacatcgaaaaatcggtaacgaagcgcattgaggat
gcatatcagaaagttccgtctaaaaaggaacacactgcttgtgaaattgaacttccagag
cctgtatcaaacggtttcccagatgtggacacttcgattgattttgatgtgctccgcaag
ctgaatggcgaattgatcaactggccggagtcatttaatgttttcggcaagctaaagcgc
attttagaaagacgcgccaaggcgttcgatgatgacagaaaagtggaatggtctttggca
gaatcactcgcgtttgcttcaattttgaaagacggaacaccgattcgtttaacaggacag
gattccgagcgcggaacgttcgcccaaagaaaccttgtgcttcatgacagtgagacgggc
aaagaatttgtgccgcttcatcacttatctgactgcagcacatcatttgctgttcataac
agcccgctgtctgaaggatcggttctcggttttgaatacggctataacgtgcattcaccg
gaaacgcttgttttgtgggaagcacagtacggagattttgccaacgctgctcaagtgtat
tttgaccaatttatttctgccggacgcgcgaaatggggccaaaaatccggattagtcatg
ctgctcccgcacggttacgagggacaggggcctgagcactcaagcggaagaattgagcga
ttcctgcagcttgcagcggaaaacaactggacggttgccaacctgacaagcgcggcacag
tatttccatattttaagaagacaggctaaaatgctgcttcgtgaagaaatcagaccgctc
gtcattatgacgccgaagagccttcttcgcaacccaaatacggtgtcggaagtgcaggag
ctcagcgaaagccgcttccagcctgtttatgaacagtcgggactttctcatgactatgaa
aaagtaaccagacttgtattatccagcggtaaagtgtctatagacattagcgatcatttt
aataagttagaagacggtaaagagtggcttcacattgcgagaatcgaacagctgtatcca
ttcccggcaaaaggagtcaaagaattatttgcaaaacttccgaacctgaaagaaatcgtt
tgggtgcaggaagagccgcagaacatgggggcttggggttatatcagcccgtatttgaca
gagattgcaccagagggagtaagcgttcaatatattggacgaagaagacgatccagccct
gcagagggagatccgacagttcataaaaaagaacaggaacgtattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system