KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02167
Entry
BSUA_02167        CDS       T03443                                 
Symbol
yosJ
Name
(GenBank) hypothetical protein
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: AIC40447
LinkDB
Position
complement(2139426..2139620)
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system