KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02319Help
Entry
BSUA_02319        CDS       T03443                                 

Gene name
yokL
Definition
(GenBank) acetyl-transferase
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_10 Acetyltransf_7 Acetyltransf_8 FR47 Acetyltransf_9 Lipoprotein_16
Motif
Other DBs
NCBI-ProteinID: AIC40599
LinkDB All DBs
Position
complement(2246757..2247290)
Genome map
AA seq 177 aa AA seqDB search
MAVTYWTGENLTLRAIQPEDIVIFDSLDDEILRNMDSLHFPRSANNMREWVEEQLEKDEF
RFIAVESDNNIVGMIETFDCDRKNGTFGYYLAVFEPYRGKGFAKEMILMVLRFFFLELAY
QKVNTTVYSFNNPSIRLHEKLGFMKEGQLRKIIFTKGAYYDGICFGMTREEFELNHG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcagttacttattggacaggggagaatcttacactgcgagcaattcaacctgaagat
atcgttatatttgattcgttagatgatgaaattctgcgaaatatggactcgctacatttt
cctcgttcagctaataacatgagagaatgggtagaagaacaattagaaaaagatgaattc
cgttttattgcagttgaaagtgataataatatagtaggtatgattgaaacctttgactgt
gataggaaaaatggtaccttcggttattatttggctgtattcgagccatataggggcaaa
ggatttgccaaagaaatgatcttgatggttcttcgctttttctttttggaacttgcttat
caaaaagtaaatacaactgtttattcttttaataatccatccatacgattacatgaaaaa
ttaggtttcatgaaagagggacaactaagaaagatcattttcactaaaggtgcctattat
gatggtatttgctttgggatgacaagagaagaatttgaactgaatcatggataa

DBGET integrated database retrieval system