KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02706
Entry
BSUA_02706        CDS       T03443                                 

Gene name
era
Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsul03009]
    BSUA_02706 (era)
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_02706 (era)
Ribosome biogenesis [BR:bsul03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BSUA_02706 (era)
 Prokaryotic type
  GTPases
   BSUA_02706 (era)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_02706 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU Dynamin_N PduV-EutP RsgA_GTPase AIG1 MMR_HSR1_Xtn cobW Ras Roc AAA_22
Other DBs
NCBI-ProteinID: AIC40984
LinkDB
Position
complement(2582807..2583712)
AA seq 301 aa
MTNESFKSGFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRNKVQGVLTTGTSQTIF
IDTPGIHKPKHKLGDFMMKVAQNTLKEVDLILFMINAEEGYGKGDEFIIEKLQTMSTPVF
LIVNKIDKIHPDQLLLLIDEYRKRYPFKEIVPISALEGNNIETLLAQIEAYLPEGPQFYP
SDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKGQDNGSVHVAATIVVERDS
QKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVKVQKDWRNKMSQLRDFGFKEDE
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
atgacgaacgaaagctttaaatcaggatttgtatccattattggaagaccaaacgtagga
aaatctacatttttgaacagagtcattggacaaaaaatcgcgatcatgagcgataagccc
caaacgacgagaaacaaggtgcaaggagtactgacgacaggcacatcacaaaccattttt
attgacacaccagggattcataaacctaagcataaacttggggactttatgatgaaagtg
gcgcaaaatacattaaaagaagtcgatttgatcttgtttatgatcaatgctgaggaaggc
tacgggaagggcgacgaattcatcattgagaaattgcagacgatgtctacgcctgtattc
ttaatcgtaaacaaaattgataaaattcatcccgaccaattgcttctgctaattgacgaa
taccgcaaacgttatccttttaaggaaattgttccgatttctgctttagaaggaaataac
atcgaaaccttgctcgcgcagatcgaagcgtatttgccggaagggccgcaattctatccg
agtgaccaggtaactgaccaccctgaacgatttatcatttctgaattaatcagggaaaag
gtgctgcatttgacgagagaagaaatcccgcacagcattgcggtggccatcgaatccatc
aaagggcaggacaacggttctgtgcacgtagcggcaacgattgtggtcgagcgggattcc
cagaaaggcatcgtgatcggtaaaaaaggaagccttctaaaagaggttggaaaaagagcg
agagcggatattgaagcactgttgggctcccgtgtctaccttgaattgtgggtgaaagtg
cagaaagactggcgtaataaaatgtcccagcttcgcgattttggctttaaagaggacgaa
tattaa

DBGET integrated database retrieval system