KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02886
Entry
BSUA_02886        CDS       T03443                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00051  Fructose and mannose metabolism
bsul02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUA_02886 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUA_02886 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsul02000]
    BSUA_02886 (levG)
Transporters [BR:bsul02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUA_02886 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AIC41162
LinkDB
Position
complement(2732999..2733826)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaagaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttacagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgatccaattttttggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggtcct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcgggttatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaacggtacaaaacgtgctagatagcattatgccgggggcgctgcctctcggatta
acgttattggtggcatggatgcttcgcaaaggggtgaatccacttctcattatttgcggc
atctttgtcatcgggattctcgggtattgggctggattcttagcataa

DBGET integrated database retrieval system