KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_02887
Entry
BSUA_02887        CDS       T03443                                 

Gene name
levF
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00051  Fructose and mannose metabolism
bsul02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUA_02887 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUA_02887 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsul02000]
    BSUA_02887 (levF)
Transporters [BR:bsul02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUA_02887 (levF)
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: AIC41163
LinkDB
Position
complement(2733847..2734656)
AA seq 269 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggaatcgcaagt
gtattggatgaagggcagacacaccggccgctagtggcctgtacgttggttggcttggtg
ctcggggacttaaaaacgggaattattcttggaggcacactggagctgatggcgctcggc
tggatgaacgtcgggcttgccatggcacctgatacagcgatcgcctctgtcatctcaacc
attttagttattaccgctgatcaaggaattggcgaagggattgctgtcgctgttgcttta
gcagctgcgggtcaggcgctgacgatttttgttcggacgatcactgtctttttcatccac
cgcgctgatcaatatgcaaaagcgggaaatataaaaggaattgaaattatgcatattacc
gcgatggtgtttcaagctttgcgcgtcatgattcctacattgattgttgctttaattagt
gtcagcgctgttcaggcgttcctgggaaatattcctgatgtcattacaaaaggactgcaa
ataggcggaggcattattgtggttgtcgggtatgccatggtgatcaatatgatgaatatt
ccttatttaaagccatttttctatattggtttcttattagcggcgtttaccgattttaac
ttagtgggatttggagcccttggtctctgtctggcgcttttataccagcaggtgatgcaa
aaacaaagcgctcacggagcagtcgcggccgcatcagacagtggcagtgttgctgtttat
gatgacgatgatgatgatcttgatgcctaa

DBGET integrated database retrieval system