KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03101Help
Entry
BSUA_03101        CDS       T03443                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00020  Citrate cycle (TCA cycle)
bsul00480  Glutathione metabolism
bsul01100  Metabolic pathways
bsul01110  Biosynthesis of secondary metabolites
bsul01120  Microbial metabolism in diverse environments
bsul01130  Biosynthesis of antibiotics
bsul01200  Carbon metabolism
bsul01210  2-Oxocarboxylic acid metabolism
bsul01230  Biosynthesis of amino acids
Module
bsul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUA_03101 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSUA_03101 (icd)
Enzymes [BR:bsul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSUA_03101 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIC41376
LinkDB All DBs
Structure
PDB: 

Position
complement(2952482..2953753)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtctctaacggagtattaaacgtaccaaacaacccg
attatcccatttatcgaaggagacggaaccggtcctgatatttggaacgcggcttcgaag
gttttggaagcagcagtagaaaaagcatacaaaggcgaaaagaaaattacatggaaagaa
gtttacgccggagaaaaggcttataataaaacaggtgagtggctccctgctgaaacatta
gatgtgatccgcgaatatttcatcgcgattaaaggcccgttaacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtatgcaaaaggctct
gaagaagtgcaaaagcttatcagcttccttcaaaatgagttaaacgtcaataaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttcagaagaaggaacaagccgcttg
gtcagagctgccattgattatgcgatcgagcatggccgcaaatctgtaacacttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaactggggctatgaacttgct
gaaaaagaatacggagataaagtcttcacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagacgctgccaacaaagcgcaaagcgaagcggaagcagcaggaaaaatcatt
atcaaagacagcattgctgacattttccttcagcagatcttaacgcgtccaaacgagttt
gatgtcgttgcgacaatgaacttgaacggagattacatttctgatgctcttgctgcgcaa
gtcggcggaatcggcattgctcctggagcgaacatcaactacgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttaggatggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttctaaagtcgtaacttacgattttgcc
agattaatggacggggcgactgaagtgaaatgttcagagttcggagaagaactgatcaaa
aacatggactaa

DBGET integrated database retrieval system