KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03221
Entry
BSUA_03221        CDS       T03443                                 

Gene name
leuS
Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSUA_03221 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsul01007]
    BSUA_03221 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsul03016]
    BSUA_03221 (leuS)
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_03221 (leuS)
Enzymes [BR:bsul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BSUA_03221 (leuS)
Amino acid related enzymes [BR:bsul01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BSUA_03221 (leuS)
Transfer RNA biogenesis [BR:bsul03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSUA_03221 (leuS)
 Prokaryotic type
    BSUA_03221 (leuS)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_03221 (leuS)
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Other DBs
NCBI-ProteinID: AIC41496
LinkDB
Position
complement(3075396..3077810)
AA seq 804 aa
MSFQHKEIEKKWQTYWLENKTFATLDNNEKQKFYALDMFPYPSGAGLHVGHPEGYTATDI
LSRMKRMQGYDVLHPMGWDAFGLPAEQYALDTGNDPAVFTKQNIDNFRRQIQALGFSYDW
DREINTTDPEYYKWTQWIFLKLYEKGLAYVDEVPVNWCPALGTVLANEEVIDGKSERGGH
PVERRPMKQWMLKITAYADRLLEDLEELDWPESIKDMQRNWIGRSEGAHVHFAIDGHDDS
FTVFTTRPDTLFGATYTVLAPEHALVENITTAEQKEAVEAYIKEIQSKSDLERTDLAKTK
TGVFTGAYAINPVNGEKLPIWIADYVLASYGTGAVMAVPGHDERDFEFAKTFGLPVKEVV
KGGNVEEAAYTGDGEHVNSDFLNGLHKQEAIEKVIAWLEETKNGEKKVTYRLRDWLFSRQ
RYWGEPIPVIHWEDGTSTAVPEEELPLILPKTDEIKPSGTGESPLANIKEWVEVTDPETG
KKGRRETNTMPQWAGSCWYFLRYIDPHNPDQLASPEKLEKWLPVDMYIGGAEHAVLHLLY
ARFWHKFLYDIGVVPTKEPFQKLYNQGMILGENNEKMSKSKGNVVNPDEIVASHGADTLR
LYEMFMGPLDASIAWSESGLDGARRFLDRVWRLFIEDSGELNGKIVEGAGETLERVYHET
VMKVTDHYEGLRFNTGISQLMVFINEAYKATELPKEYMEGFVKLLSPVAPHLAEELWEKL
GHSGTIAYEAWPVYDETKLVDDEVEIVVQLNGKVKAKLQVPADATKEQLEQLAQADEKVK
EQLEGKTIRKIIAVPGKLVNIVAN
NT seq 2415 nt   +upstreamnt  +downstreamnt
ttgagttttcagcacaaagagatagaaaagaaatggcagacatattggcttgaaaacaaa
acatttgccactcttgataataatgaaaaacaaaaattttacgcgctggacatgtttcct
tatccgtctggagctgggttgcacgtcggccatcctgaaggatacacagctacggatatt
ctgtcccgcatgaagcgcatgcagggctatgatgtccttcatccaatgggctgggacgca
ttcggcctgccagctgaacagtacgcgcttgacacagggaacgaccccgctgtgtttacg
aagcagaatattgataacttccgccgccaaattcaagcgcttggcttctcatatgactgg
gatcgcgaaatcaatacgactgaccctgaatactataaatggacgcaatggattttctta
aagctatacgaaaaaggccttgcttacgttgacgaagtgcctgtaaactggtgccctgcg
ctcggtactgttcttgccaacgaagaagtcattgacggcaagagcgaacgcggcggccat
ccggtagagagacgcccaatgaagcagtggatgctgaaaatcaccgcttatgcggacagg
ctccttgaggacttggaagagcttgattggccggaaagcattaaagatatgcagcgcaac
tggatcggccgttcggaaggcgctcacgttcattttgctatagatggacatgatgattcc
tttacagtgtttacaacaagaccagatacgctgtttggcgctacatacactgtccttgcc
ccggaacacgcattggtggaaaacatcacaacggcagagcaaaaagaagctgttgaagct
tatatcaaagaaattcaatcaaagagtgacctagaacgcacagatcttgcgaaaacaaag
acaggcgtatttacaggagcgtatgcgatcaatcctgtaaacggagaaaaactgccgatt
tggattgcggattatgttcttgcatcatacggaacaggtgctgtcatggcagttccagga
cacgatgagcgtgattttgaattcgccaaaacattcggccttccggtgaaggaagtcgta
aaaggcgggaacgttgaggaagcagcctatactggcgacggcgagcacgtgaactctgat
ttcctgaacggccttcacaaacaggaagcgattgaaaaagtgatcgcttggctggaagaa
acgaaaaacggtgagaagaaagtgacgtaccgtcttcgtgactggctcttcagccgccag
cgttattggggcgagccgattccggtcattcattgggaagacggaacgtcaacagctgtc
ccggaagaggagctgccgctgattttgccaaaaacggatgaaatcaaaccgagcggaacg
ggcgaatcaccgcttgcgaacattaaagagtgggtggaagtcacagaccctgagacaggg
aaaaaaggaagaagagaaacgaatacaatgccgcaatgggcgggaagctgctggtatttc
ttgcgctatattgatccgcacaatccggatcagctggcatcaccagaaaaattggaaaaa
tggcttccggtcgatatgtatatcggcggtgcagaacatgccgtgcttcaccttctgtat
gcccgcttctggcataagttcctttatgatatcggcgtagtgccgacgaaagaaccgttc
caaaagctgtacaaccaaggaatgattctcggcgaaaacaacgaaaaaatgagtaaatct
aaagggaacgttgtcaatcctgacgaaatcgtggcctctcacggtgctgatacgctgaga
ttgtacgaaatgttcatgggacctcttgatgcttcaatcgcctggtctgaatcaggatta
gacggtgcgcgccgtttccttgaccgtgtatggcgcctatttattgaagacagcggtgag
cttaatggaaaaatcgttgaaggcgcgggtgaaacattggagcgcgtctatcatgaaacg
gtcatgaaagtcacagaccattatgaaggccttcgtttcaacacgggtatttcccagctg
atggtctttattaatgaagcttataaagcaacagaactgccgaaagaatatatggaaggc
ttcgtgaagcttctttctcctgtcgcgccacacttagcggaagagctatgggagaagctt
ggccattccggcacaattgcctacgaagcttggcctgtatatgatgaaacaaaacttgtg
gatgatgaagttgaaatcgttgttcagctgaacggaaaagtaaaagcgaaattacaggtt
cctgccgatgcaacgaaagaacagctggaacagcttgctcaagcagatgaaaaggtcaaa
gagcagcttgaaggcaaaacgattcggaaaatcatcgcggtgcctgggaagcttgtcaat
attgtggcaaactaa

DBGET integrated database retrieval system