KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03515Help
Entry
BSUA_03515        CDS       T03443                                 

Gene name
yusT
Definition
(GenBank) LysR family transcriptional regulator
  KO
K21959  LysR family transcriptional regulator, cell division regulator
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsul03000]
    BSUA_03515 (yusT)
Transcription factors [BR:bsul03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    BSUA_03515 (yusT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AIC41765
LinkDB All DBs
Position
3350660..3351547
Genome map
AA seq 295 aa AA seqDB search
MESGDLRVFQMVAREGTITKAALQLGYVQSNVTARIQQLEAELGTTLFLRHNRGMTLSAS
GKLLLDYANKIIGLLDEASKALSSSAEPSGPLMIGCTQTTAAVRLPKLLASYYEEHPNVQ
LSLTTGHTQFLLDKVLRYELDGAFIGCECHHPELESYPAFEEEPVVVSAASVPDVEEAIT
KPILVYSTGCSYRETLEKWLRSVGVTQPVIMEFGTLEAIIGGVTAGLGISLLPRTVVQKH
EAEGSIRLYPLPEALSQMKTEFIVRKDSFISSALRTFMDSFTPVKTAESQKSSLL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcggagatttacgtgtgtttcaaatggtagctcgtgaagggaccattacgaaa
gcagccctgcagcttggctatgtacaatcgaatgtcacggccagaattcaacaattggaa
gctgagctgggtaccacactgtttttgcgccataatcggggcatgacactttctgcaagc
ggaaaattgctgctggactacgcaaataaaattataggccttcttgatgaagcgtctaaa
gcgctctcatcctccgcagaaccaagcgggccgcttatgatcggctgcactcagacaacc
gccgcggtaaggcttccaaagcttctggcatcttattatgaagaacatccaaacgtccag
ctgtctttaacaacaggacatacgcaatttctccttgataaagttcttcgttatgaattg
gatggcgcgtttatcggatgcgaatgccatcatcctgagctcgaatcctatcctgcgttt
gaggaagaaccagtagttgtttcggctgcctccgtgcccgatgttgaggaagccatcaca
aagccgattctcgtttacagcacaggctgttcgtatcgagaaacacttgaaaaatggctg
cgttccgtcggtgtcacacagccggtcattatggaatttgggacgcttgaagcaattatc
ggcggggttacagcaggtcttggcatctcgttgctgccaagaacggttgtgcagaaacat
gaagcagaaggatcaattcgattgtacccgctgcctgaagctctcagccagatgaaaaca
gagtttattgttcgaaaagattcgtttatcagcagcgcgctgagaacctttatggattcc
tttacgccagttaaaacggctgaatcacaaaaaagcagtctgctataa

DBGET integrated database retrieval system