KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03517Help
Entry
BSUA_03517        CDS       T03443                                 

Gene name
yusV
Definition
(GenBank) iron(III)-siderophore transporter ATP binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsul02000]
    BSUA_03517 (yusV)
Transporters [BR:bsul02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSUA_03517 (yusV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_16 SMC_N AAA_29 ABC_ATPase AAA_30 RsgA_GTPase AAA_23 AAA_25 AAA_33 AAA_28 AAA_5 NACHT SRP54 AAA AAA_19 AAA_18 Viral_helicase1 DUF2891 Rad17 AAA_22 Mg_chelatase RNA_helicase Zeta_toxin AAA_27 ATP-synt_ab ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIC41767
LinkDB All DBs
Position
complement(3351879..3352706)
Genome map
AA seq 275 aa AA seqDB search
MGMSAISTETLSLGYGDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGG
SVLLEGRAIAKLPTKEVAKELAILPQGPSAPEGLTVHQLVKQGRYPYQNWLKQWSKEDEE
AVERALKATKLEDMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEI
LDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVFS
MNCQVTQDPLFGTPLCIPHGRGRCIVQEAAFTSHG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagtgcaatttctacagaaacgctgagcttaggatacggggatgccgttatt
attgatgagttgaatttaacaattcccaaaggtgaaattaccgtatttattggcagcaat
ggctgcggaaaatcgacacttttacgttcattagcgcgcctgatgaagccgagaggcggt
tcagtgctgctggaaggaagagcgattgccaagcttccgacgaaggaagtcgcaaaagag
ctcgcaatcctgccccaaggtccttcggctccagaggggctgacggtgcatcagctggtg
aagcaaggaagatatccttaccaaaactggctgaagcagtggtcaaaagaggatgaggaa
gcagttgaaagagcgcttaaagcaacaaagcttgaggacatggctgaccgtgccgttgat
tctttgtcaggcggacagcgccagcgggcttggatcgcgatgacgcttgcccaggaaacg
gatatcatccttcttgacgagccgacgacgtatttagacatgacgcatcaaattgaaatt
cttgatttgctgtttgagctgaatgaaaaggaagaccggacgattgttatggttctccat
gacttaaacttggcgtgccgctatgcgcatcatcttgtggccataaaagataaacggatt
tatgcagaaggccgtccggaagaggtcatcacttgtgatcttgtgcaaaatgtgttttct
atgaactgtcaggttacacaggacccgctcttcggaacgcctctttgcattcctcatggc
aggggcagatgcattgtccaggaagcggctttcacatcacatggataa

DBGET integrated database retrieval system