KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_03785Help
Entry
BSUA_03785        CDS       T03443                                 

Gene name
tuaH
Definition
(GenBank) glycosyltransferase
  KO
K16699  teichuronic acid biosynthesis glycosyltransferase TuaH [EC:2.4.-.-]
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsul01003]
    BSUA_03785 (tuaH)
Enzymes [BR:bsul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSUA_03785 (tuaH)
Glycosyltransferases [BR:bsul01003]
 Others
  Other glycosyltransferases
   BSUA_03785 (tuaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AIC42032
LinkDB All DBs
Position
complement(3622642..3623841)
Genome map
AA seq 399 aa AA seqDB search
MKVETKEAIIHVIVATAEWGKDQLRYRRHRLAEFLAAQEETKEVIWVCPAPRAQGKEFQE
VHSGIRQFAVKDLLQKKMFRFGRYTDVFYRHKLSPLLDELTPASANGERCCLWYTFPGFP
LLSSLYSWDQVIYDCSDLWAAPISGRSNLLSEFRRKVIKSAELRIIQRADSITCSSDYLH
KEVDKKLTAGREKVHTVENGVEYELFSANKQAPDRSILQGREGIVLGFIGGIKPKLDFKM
IKEAALQKPDWTFLWVGPDATNGDVSFQELLRLPNVIWTGPADPKEVPHYMELIDIGIMP
YKQSPYNQAVFPLKLFEFLAAGKPVVGTNLPSTSKMQKPYVYEYVEGDHPIDFIAACEKV
LGQNGDETYKEMRRNIARTQDWNCLFRQIMKYTGIQKHA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaaacaaaagaagcaatcattcatgtcatcgttgccactgctgaatgggga
aaagaccaattgagatacagaaggcaccggctggcagaatttttagctgctcaggaggaa
acgaaggaagttatttgggtatgtccggctccgcgtgcccaagggaaagagtttcaggaa
gtccattctggcatcaggcaattcgctgtcaaagacctgctgcagaaaaaaatgtttcgt
ttcggacgatatacagatgtcttttacagacataagctctccccattactcgatgagctt
acacctgcttctgcaaacggtgaacgctgctgtttatggtacacgtttcccggattcccg
ctgctgtcttcgctgtattcttgggatcaggtcatttatgactgcagtgacctatgggct
gcgccgatcagcggccgatcaaatctgctgtctgaattccggcgaaaagtcattaaatcg
gcagagctgagaattatacaacgagcagattcaataacctgttcatcagattatcttcac
aaggaagtagacaaaaaactgactgcaggacgagaaaaggttcatactgtggaaaacggt
gtggagtatgagctgttttctgcaaataaacaagctcccgatcgcagtatactgcagggg
agagaaggaatagtgttaggttttattggcgggattaaaccgaagctcgattttaaaatg
attaaagaagcggcactgcaaaagcctgattggacatttttatgggttggcccggatgcc
accaatggtgatgtttcgtttcaagagctgctgaggcttcccaatgtcatatggaccggt
ccggcagatccaaaagaagtgcctcattatatggagcttatcgacattggcattatgcca
tataaacaatcaccgtataatcaagctgtgtttccgctgaaactatttgaatttttagcg
gcaggaaaacctgttgtaggcactaatcttccgtcaacctcaaaaatgcaaaagccgtat
gtatacgaatatgtagagggcgatcatccgattgattttatagccgcttgtgaaaaagtt
ctcggtcaaaacggagacgagacctataaagaaatgcgccgaaacatcgcccggacacaa
gattggaattgcttatttagacaaattatgaaatatacagggattcaaaaacatgcgtag

DBGET integrated database retrieval system