KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_04318Help
Entry
BSUA_04318        CDS       T03443                                 

Gene name
yybH
Definition
(GenBank) hypothetical protein
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_3 DUF4440 SnoaL_2 mCpol SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AIC42559
LinkDB All DBs
Structure
PDB: 

Position
complement(4150519..4150908)
Genome map
AA seq 129 aa AA seqDB search
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFN
HHIVPTQGKMILLEAGDTVLVLSQTLLDSDKKDSEYAMERRATYVFKKNAQGEWLCVIDN
SYGTDLIGV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ttggaacagcaattgaaagacatcatctctgcgtgtgatttggcaatccaaaatgaagat
tttgatacactgatgaattattattcggaagatgccgttttagttgtgaagccgggcatg
atcgcgcgaggcaaggaagaaatcaaaaaagcgtttatcacgattgcgaactatttcaat
catcatattgtcccgacacaagggaaaatgatcctgttggaagcaggtgacacggtactc
gttctttctcagacactgcttgattcggataaaaaggactccgagtatgcgatggaaaga
agggcgacctatgtatttaaaaagaatgcgcaaggcgagtggctttgtgtaattgataat
tcatatggtacggatttaattggtgtgtaa

DBGET integrated database retrieval system