KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_04324Help
Entry
BSUA_04324        CDS       T03443                                 

Gene name
yybB
Definition
(GenBank) hydrolase
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-ProteinID: AIC42565
LinkDB All DBs
Position
complement(4155399..4156061)
Genome map
AA seq 220 aa AA seqDB search
MNLRQLSEHVFQCEFELDVPLRIPVHTWFIKDGDDVYIVDTGIERFADAQIRAALAIGNP
KAILLTHGHSDHIGGASKWLERFDIPIFAHQKELKYINGEEPYPNKNEVENTGVAHIVQP
LTEQTLAHLPLKYYLTPGHSPGHVVYYHKIDRTLLTGDLFITSKEDLHPPIRRFSVDINE
NIDSGSIIDQIKPTLICSSHGEEILYNEELYKNYVVRYRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttgagacaactatcagaacatgtctttcaatgtgaatttgagcttgatgtgcct
cttcgtattccggttcatacctggtttatcaaagatggtgatgatgtttatattgttgat
acgggaatagaacgttttgctgatgctcaaattagggcagcgttagcgatcggcaatcca
aaagccattttgcttacccatggccacagtgatcatatcgggggtgcatcaaaatggtta
gagagatttgatattccgatttttgcgcaccagaaagaactaaagtacatcaatggggaa
gagccatatccgaacaaaaatgaagtggagaacacaggggtagcccatattgtacagccg
ctgacggagcaaacgcttgctcatctgcctctgaaatactatttaacacctggccattcg
ccggggcatgttgtgtattatcataaaatcgatcgtacgctattgacgggcgaccttttt
atcacaagtaaggaggatttacacccacctataagaagattcagtgttgatataaatgag
aacatcgacagcggctcaatcatagatcaaatcaaaccaacgctcatttgctcttcacat
ggcgaagaaatcctttataacgaagaattgtataaaaactatgtggtaaggtatagggat
taa

DBGET integrated database retrieval system