KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_04345
Entry
BSUA_04345        CDS       T03443                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Pathway
bsul03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSUA_04345 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsul03011]
    BSUA_04345 (rpsF)
   03029 Mitochondrial biogenesis [BR:bsul03029]
    BSUA_04345 (rpsF)
Ribosome [BR:bsul03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSUA_04345 (rpsF)
  Bacteria
    BSUA_04345 (rpsF)
Mitochondrial biogenesis [BR:bsul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSUA_04345 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 AbiJ_NTD3 NAS
Other DBs
NCBI-ProteinID: AIC42586
LinkDB
Position
complement(4172208..4172495)
AA seq 95 aa
MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY
QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE
NT seq 288 nt   +upstreamnt  +downstreamnt
atgagaaagtacgaagttatgtacattatccgcccaaacattgacgaagagtctaaaaaa
gcagttatcgagcgtttcaacaacgttctgacttctaacggtgcggagatcactggaaca
aaggattggggtaaacgtcgtcttgcttacgaaatcaacgatttccgcgacggtttctac
caaatcgtaaacgttcaatctgacgctgcggcagttcaagaatttgaccgtctagctaag
atcagtgacgatatcattcgccacattgttgttaaagaagaagaataa

DBGET integrated database retrieval system