KEGG   Brucella suis bv. 2 PT09143: BSPT1_I0557Help
Entry
BSPT1_I0557       CDS       T03503                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00061  Fatty acid biosynthesis
bsup00780  Biotin metabolism
bsup01100  Metabolic pathways
bsup01212  Fatty acid metabolism
Module
bsup_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSPT1_I0557 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSPT1_I0557 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsup01004]
    BSPT1_I0557 (fabZ)
Enzymes [BR:bsup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BSPT1_I0557 (fabZ)
Lipid biosynthesis proteins [BR:bsup01004]
 Fatty acid synthase
  Component type
   BSPT1_I0557 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AIB20659
LinkDB All DBs
Position
I:530997..531446
Genome map
AA seq 149 aa AA seqDB search
MEAADIQALLAVLPHRYPFLLIDRIVDIDGDVSATGIKNVTINEPHFTGHFPENPIMPGV
LIVEAMAQTAGAISLLQRKTGRPGVVYFMTIDNAKFRRPVVPGDRLLLHVKKIKQRANIS
KYECVAEVDGVKVAEAEVAAMISVADENL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggaagccgcggatattcaggcactcctggctgtgcttccgcatcgttatccctttttg
ctgattgaccgcattgtggatatcgatggtgacgtatcggcgactggtatcaagaacgtg
accatcaatgaaccacattttactggccatttccccgaaaatccgatcatgccgggtgtg
ctgattgtcgaagccatggcccagaccgctggcgcgatctcgctcctgcaacgcaagacc
ggtcgccccggcgtcgtctatttcatgacgatcgataatgccaagttccgccgcccggtg
gttccgggcgatcgtctgctgttgcatgtgaagaagatcaagcagcgggcgaatatttcc
aagtatgaatgcgtggccgaagtcgatggcgtaaaggttgccgaagctgaagtcgctgcc
atgatcagcgtagctgacgagaacctgtga

DBGET integrated database retrieval system