KEGG   Brucella suis bv. 2 PT09143: BSPT1_I0810Help
Entry
BSPT1_I0810       CDS       T03503                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00061  Fatty acid biosynthesis
bsup00620  Pyruvate metabolism
bsup00640  Propanoate metabolism
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
bsup01120  Microbial metabolism in diverse environments
bsup01130  Biosynthesis of antibiotics
bsup01200  Carbon metabolism
bsup01212  Fatty acid metabolism
Module
bsup_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSPT1_I0810 (accC)
   00640 Propanoate metabolism
    BSPT1_I0810 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSPT1_I0810 (accC)
Enzymes [BR:bsup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BSPT1_I0810 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BSPT1_I0810 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 GARS_A DUF2163
Motif
Other DBs
NCBI-ProteinID: AIB20905
LinkDB All DBs
Position
I:785164..786405
Genome map
AA seq 413 aa AA seqDB search
MHVRLADESVCIGPPPSRDSYLNIHQIVAACEITGADAIHPGYGFLSENAKFAEILEAHD
ITFIGPTASHIRIMGDKIEAKRTAKRLGIPVVPGSDGGVTDEVEAARIAKEIGYPVIIKA
SAGGGGRGMKVARSAEELPIALATARSEAGAAFGDDAVYIEKYLEKPRHIEVQVMGDGAG
NAVHLGERDCSLQRRHQKVWEEGNSPALNAEAREKIGMICANACAELGYRGAGTIEFLYE
DGEFYFIEMNTRLQVEHPVTEAITGIDVVHEQIRVAGGLGLSVKQKDIRFSGHAIECRIN
AEDPPTFAPSPGLITHYHTPGGLGVRVDSGVYSGYRIPPYYDSLIGKLIVHGRNRVECMM
RLRRALDEFVVDGVKTTLPLFQDLISNQDIANGDYDIHWLEKYLANKSKNESA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcgcctggcagatgagagcgtatgcatcggaccgccgccctcacgcgacagc
tatctgaacatccatcagatcgtggccgcctgcgaaatcaccggcgcggatgcaattcac
cccggctacggcttcctttcggaaaatgcaaaattcgccgaaatccttgaagcccatgac
attaccttcatcggccccactgcttcgcatatccgcatcatgggcgacaagatcgaagcc
aagcgcaccgcaaagcgcctcggcatcccggtcgttccgggttcggacggcggcgtgacg
gatgaagtcgaggcagcccgtatcgccaaggaaatcggctatccggtcatcatcaaggct
tcggccggcggcggtggtcgtggcatgaaggtcgcccgcagcgcggaagagcttccgatc
gcacttgcgacggcacgttctgaagctggcgcggcctttggcgacgatgcggtctacatc
gaaaaatatctcgaaaaaccgcgccatatcgaagttcaggtcatgggggacggtgcgggc
aatgccgtccatctgggcgaacgcgactgctcgctgcaacgccgtcaccagaaggtctgg
gaagagggcaactcccccgccctcaatgcggaagcgcgcgaaaagatcggcatgatctgc
gccaatgcctgcgcagagcttggctatcgcggcgcaggcacgatcgaatttctctatgaa
gatggagaattctatttcatcgaaatgaatacgcgccttcaggtggaacatccggttacg
gaagcgatcaccggcatcgatgttgtgcatgagcagattcgcgttgccggaggccttggt
ctttcggtgaagcagaaggatatccgcttttccggccatgccatcgagtgccgtatcaat
gcggaagatccgccgaccttcgcaccgtcaccgggcctcatcacgcattatcatacgccg
ggcgggcttggcgtacgcgtcgattccggcgtttattccggctatcgcattccaccctac
tatgacagcctgatcggcaagctcatcgtgcatggacgtaaccgcgtcgaatgcatgatg
cgtctgcgccgcgcgctggatgagttcgtggtggatggggtaaagaccaccctgcccctg
tttcaggatctgatttccaatcaggatatcgccaatggcgattatgacatccactggttg
gaaaagtacctggccaacaagagcaagaacgaaagcgcctga

DBGET integrated database retrieval system