KEGG   Brucella suis bv. 2 PT09143: BSPT1_I1844Help
Entry
BSPT1_I1844       CDS       T03503                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
bsup01130  Biosynthesis of antibiotics
bsup01230  Biosynthesis of amino acids
Module
bsup_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSPT1_I1844
Enzymes [BR:bsup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSPT1_I1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 RsgA_GTPase AAA_30 TsaE AAA_22 AAA APS_kinase 6PF2K AAA_17 SRP54 AAA_5 DUF815 ABC_tran AAA_16
Motif
Other DBs
NCBI-ProteinID: AIB21918
LinkDB All DBs
Position
I:complement(1766287..1766889)
Genome map
AA seq 200 aa AA seqDB search
MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIET
VSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISI
WINADLDVLMERVSRRQNRPLLRNSDPRGVMQRLMDERYPVYALAELHLMTRDEKKEVIA
AELIEVLAAHLEKEQAASAG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtacgaacaaacaaacaaatcttcacaggcagacggaaacgatccgccagctg
ctcggcagtaaagtggttgttctcgttggcctgatgggagccggaaaatccaccatcggc
cgcaaggtggcgaacatgctcaacctgccgttcaaggatgcggatacggaaattgaaact
gtttcgcggatgactgttgccgaactgttcgaggcctatggggaagtggaatttcgcgat
ctcgaacgtcgcgtgatcctgcgccttctcgatgacggccccatggtgctggcgaccggc
ggcggcgcctatatgaacgccgaaacccgcgcggcgattgccgaagcggggatttccatc
tggattaatgccgatctcgacgtcttgatggagcgcgtttcgcgccgccagaaccgtccc
cttttgagaaacagcgatccgcgcggcgtcatgcagcggctgatggacgagcgctacccg
gtttatgcgctggccgagctgcatctgatgacgcgcgatgagaaaaaggaagtgattgcc
gcagaactgatcgaggttctggcggcgcatctggaaaaggaacaggccgcttccgccgga
tga

DBGET integrated database retrieval system