KEGG   Brucella suis bv. 2 PT09143: BSPT1_II0002Help
Entry
BSPT1_II0002      CDS       T03503                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00010  Glycolysis / Gluconeogenesis
bsup00020  Citrate cycle (TCA cycle)
bsup00620  Pyruvate metabolism
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
bsup01120  Microbial metabolism in diverse environments
bsup01130  Biosynthesis of antibiotics
bsup01200  Carbon metabolism
Module
bsup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSPT1_II0002
   00020 Citrate cycle (TCA cycle)
    BSPT1_II0002
   00620 Pyruvate metabolism
    BSPT1_II0002
Enzymes [BR:bsup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSPT1_II0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIB22083
LinkDB All DBs
Position
II:1456..2721
Genome map
AA seq 421 aa AA seqDB search
MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLL
VKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPA
SGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAA
PAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI
NEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEGGLITP
IIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLGMYGVKSFSAIINPPQ
SAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIEDPMSLL
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcgtattgcctgccctttcggcaggaatggaagatgcagtcatcgcg
cgctggctcaaggccgaaggcgacgcggtgagcaagggcgacctgatcgccgaagtcgaa
accgacaaggcgacgatggagcttgaagccgaagtggatggccgcattggccagcttctg
gtgaaggacggtgcgcgcgccaatgtcaatcaggtgatcgccctgcttttgaaggaaggc
gaagatgcttctgcaatggccggatttgcggtcggctccagtcctgtggccgtggcagaa
gccgaaacccctgttgcagcctcgccggtgccagccgcaccagcagtaagcgcgcccgcc
tccggtgaagtgcgccacaaggcttcgccgctcgcccgccgcctggctgcggaactgggc
gtttcgctggacgggcttgcgggaagtggcgcaaggggccggatcgtacggatcgacgtg
gaacgcgcggccgcctcgaagccggttccggttgccgccgctgccgctccagtcgccgca
cctgcggaagcttcgtcgaaagccattccggttggcatcggcgagtatgaagccgttccg
cacacatccatgcgccgcactattgcccgccgcctgctggaagccaagacaacggtgccg
catttctatctgaacgtggattgcgagatcgatgcgcttctggcactgcgcagccagatc
aacgagaagcgggaaggttcggcccgtatttccgtcaatgattttgtcatcaaggcttcc
gccgccgccctgcgccgggtgcccgatgccaatgtcatatggacagacgaggcgcttttg
aagctgaaggacgtcgatattgccgttgcggtggcgacggaaggcggccttatcacaccg
attattcgcagtgccgaccagatgagccttggcgctatttcggcgcagatgaagtctctg
gccgcgcgtgcccgcgaaaaccgcctgaagccggaagaattccagggcggtggcttttcg
atttccaatctcggcatgtatggtgtcaaatccttttcggccatcatcaatccgccgcaa
agcgccattctggcggttggcgcgggcgaacgccgcccaatcgaacgcaatggtgagctt
gctttcgccaccatgatgagcgtgacgctttcggttgaccatcgcgcggtcgacggcgcc
ctgggtgcgcaactgctcgcggccttcaaggccggtattgaagatccgatgtctctgctt
gtctag

DBGET integrated database retrieval system