KEGG   Brucella suis bv. 2 PT09143: BSPT1_II0297Help
Entry
BSPT1_II0297      CDS       T03503                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00250  Alanine, aspartate and glutamate metabolism
bsup00410  beta-Alanine metabolism
bsup00430  Taurine and hypotaurine metabolism
bsup00650  Butanoate metabolism
bsup01100  Metabolic pathways
bsup01110  Biosynthesis of secondary metabolites
bsup01120  Microbial metabolism in diverse environments
bsup02024  Quorum sensing
Module
bsup_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSPT1_II0297
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSPT1_II0297
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSPT1_II0297
   00430 Taurine and hypotaurine metabolism
    BSPT1_II0297
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSPT1_II0297
Enzymes [BR:bsup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSPT1_II0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIB22376
LinkDB All DBs
Position
II:290634..292028
Genome map
AA seq 464 aa AA seqDB search
MTGSNYPARDLIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLAT
FCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNT
IGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPME
PGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVD
AASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNV
DYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPY
EFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRV
MCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaactatccggcgcgggatttgattgcctctgtttttggcaccgaggct
ttacaggaaattgctgcttcgcgtggttttcgcgaaaaggaaatgcaggcgaacgctgtt
taccagattattcatgacgaactgtttctcgatggtaatgcccgtcagaatctggcgacc
ttctgtcagacatgggatgatgattacgtccacaagctgatggacctttcgatcaacaag
aactggatcgacaaggaggaatatccccagtcggcggccattgatctgcgctgtgtcaac
atggtcgcggacctctggaatgcacccaaattcgccgataatgccacaggcaccaatacg
atcgggtccagcgaggcctgtatgcttggtggtatggccatgaaatggcgctggcgcaag
aagatgcaggaaatgggcaagccgacggacaagcccaatttcgtttgtggcccggtgcag
gtgtgttggcacaaattcgcccggtactgggatgtcgagatccgggaaattccgatggag
cctggccgcctgttcatgggaccagaacaaatgcttgaagccgttgatgaaaataccatc
ggcgtcgtgcccactttcggcgtgacctataccggcaattatgaatttcccgaaccgttg
caggatgcgctggacaagctgcaaaagaccaagggtcttgatatcgatatccatgtcgat
gcggcaagcggcggctttctggcaccattttgcgcgcccgatattccgtgggatttccgc
ctgccgcgcgtgaagtcgatcagcgcgtcaggccataaatacggtctcgcaccgcttggc
tgtggctgggttgtctggcgcgacaaagaggccctgccggaagagctgatcttcaatgtg
gattatctcggtggacaggttggcactttcgcaatcaatttctcgcggcctgccggtcag
gtcatttcacaatattacgaattcatgcgtcttggccgcgaaggctacaccaaggtgcag
caggcggcctaccgcgtggcgcaatatatagccagggagatcgagccgcttgggccttat
gaattcatctgcgcgggcgaggagaaaggcggcattcccgccgtctgtttccgcatccgt
gaaggcgaagaccccggttattcgctctatgatctgtcggaacggctgcgtctgaccgga
tggcaggttcccgctttcgctctttcgggcaaggcgtcggatatcactgtcatgcgcgtc
atgtgccgccgcggtttcgagatggatctggctgcactcttcattcgggatttcaaggct
gggatcgagttcttcaaatcgcatccttcaccgaagattaccccgtcgatgggaaccggc
tttcaccacacataa

DBGET integrated database retrieval system