KEGG   Brucella suis bv. 2 PT09143: BSPT1_II0867Help
Entry
BSPT1_II0867      CDS       T03503                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsup  Brucella suis bv. 2 PT09143
Pathway
bsup00473  D-Alanine metabolism
bsup01100  Metabolic pathways
bsup01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSPT1_II0867 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSPT1_II0867 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsup01011]
    BSPT1_II0867 (alr)
Enzymes [BR:bsup01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSPT1_II0867 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bsup01011]
 Precursor biosynthesis
  Racemase
   BSPT1_II0867 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIB22940
LinkDB All DBs
Position
II:866798..867997
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTQAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQR
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgcc
ccaacccgtacggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtggcgctgaagccctttttgaaacctgacgcaacactttatgtcctgaacggccttcag
cccggaacgcaagcagcctgtgcccgcgaaggtatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgctctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctt
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcgctatatggcattgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataagaaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtc
ggctatgctgacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system