KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_00440Help
Entry
Q433_00440        CDS       T03469                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsus03110]
    Q433_00440
Chaperones and folding catalysts [BR:bsus03110]
 Heat shock proteins
  HSP33
   Q433_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIC96719
LinkDB All DBs
Structure
PDB: 

Position
79772..80647
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLSAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgcggcgaga
acgactgatatggtaaatgaggggcagagacgccatggtacgtggccgacagcatccgct
gcattgggccgcacaatgacagcttcactcatgctcagcgctatgctgaagggcgatgat
aagctgaccgtgaaaatcgagggcggaggtccgatcggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccgcaagttcattttgatttaaatgaa
caaggcaagcttgatgtcagacgtgcggttggaacaaacggaacgttaagtgtcgtaaaa
gatttaggtttgcgcgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgatttcacttactatcttgtatcatctgagcaggttccttcatcagtgggcgtaggt
gtgctcgtgaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaacaatcacaaaaattgaacagcgtctatctcaagtagagccg
atttctaagctcatccaaaaagggctgacaccagaagaaattttagaagaagtcctaggc
gagaaacctgagattttggaaacgatgcctgtcagattccattgcccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system