KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_01975Help
Entry
Q433_01975        CDS       T03469                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00910  Nitrogen metabolism
bsus01100  Metabolic pathways
bsus01120  Microbial metabolism in diverse environments
Module
bsus_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Q433_01975
Enzymes [BR:bsus01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     Q433_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 HI0933_like AlaDh_PNT_C GIDA NAD_binding_7 3HCDH_N Trp_halogenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AIC96959
LinkDB All DBs
Position
complement(343648..346065)
Genome map
AA seq 805 aa AA seqDB search
MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNRILLSKVLQGDTDIKD
ITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDELIMATGSVPFILPIPG
ADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVG
IRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLSQEAGTSITAAMSDDEIICGC
NGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKPLVEEILQHTLGSDFDASAQKEA
ICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPEGCSKCRPALNYYLGMINPTKYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNGRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagctagttcttgttggtaatggaatggccggggtaagggccattgaa
gagatactgagtgttgctaaagacgagtttcagatcacaattttcggtgccgaaccgcat
cccaattacaaccgaatccttttgtcaaaagtgcttcaaggcgatacagatattaaagat
attacgttaaacgattgggactggtacgaagaaaacaacattcaattgtatacaaatgaa
acagtcatcaaagtggacacggaaaacaaaacagtcatcacagatgcagacagaatccag
ccttacgatgaattgatcatggcgacaggctcggtcccttttatccttccgattccgggc
gcagacaaaaaaggcgtcacagctttccgggacataaaagatacagacacaatgctcgcc
gcgtcaaaacaatataaaaaagctgccgtcatcggcggaggacttcttggtttggaagca
gctcgcggactgctgaatcttggcatggatgtgtccgtcatccaccttgccccattcctg
atggagcgccagcttgatgcaacggcaggacgcctgctgcaaaacgagttagaaaaacaa
ggtatgacctttttacttgaaaagcaaacagaagaaattgtcggtgacgaccgtgtcgaa
ggcctccgattcaaggatggcacaagcattgaagctgatttagtcgtcatggctgtcggc
atccgcccaaatacaacgctcggggccgagagcggcattccggttaaccgcggcatcatc
gtcaacgattatatgcagactgaaatcccgcacatttacgcggtcggcgaatgtgccgag
caccgaggaatcgcctacgggcttgtggcgccgctgtatgaacaggcaaaagtgctggca
aagcatatgtgcggcatcgaaacaaaaccgtatgagggctccgttctctccacacagtta
aaggtatcaggcgtcgaggtcttctctgccggtgactttaacgaatcagaggagaaaaaa
gcgattaaagtcttcgatgagcaggacggcatctataaaaaaatagtcctgagaggcaat
caaattgtcggtgctgttttattcggcgacagcagcgaaggcaatcgcctgttttctatg
attcaaaaagaagccgatatctctgaaacctctaaaatatcaatcttacagcccctcagc
caggaagcaggcacaagcataaccgcagcgatgagcgacgatgaaatcatctgcggctgt
aacggcgtgtcaaaaggtgcgattattcaagccatacaggaaaagggctgctcgtcaacg
gacgaaatcaaagcatgcaccggcgcatcccgctcatgcggaggctgtaagccgctcgta
gaagaaatcctccagcatacgctcggatcagactttgatgcgtcagcgcaaaaagaagcc
atttgcggctgcaccacattgtcgagagatgaagtcgtagaagaaatcaaagccaaaggg
ctgtcacatacaagagaagtcatgaatgtgctcggctggaaaacgccagaaggctgttct
aaatgccgacccgctctgaactactacttaggcatgatcaatccaaccaaatacgaggat
gaccggacatcccgctttgttaatgaacgaatgcacgccaatattcaaaaagacggaaca
tactcagtcgttcctcggatgtacggcggcgtgaccaactccacagatttgcgcaagatc
gccgatgtcgttgacaaatatgagatcccgctcgtgaaaatgacaggcggccagcgaatt
gatcttatcggcgtgaaaaaagaagaccttccgaaggtatgggaagatcttgatatgcca
tcgggctacgcgtacggaaaaacgctccgcacagtgaaaacatgtgtaggcgagcaattc
tgccgcttcggcacacaagactccatggcactgggcattgcgcttgagaaaaaattcgaa
gggctgaacacgcctcacaaagtcaaaatggccgtgtctgcctgcccgcgaaactgtgcg
gaatccggcattaaggaccttggcgttgttggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccatttgcgtgccggcgatttgctgatgaaggtgaaaacaaat
gaagaagtcttagaatacgcgggcgcttacctgcaatattacagggaaaccgcaaactat
ctggagcgtacgtccgcatggcttgagcgcgtcggtttatcccatgtccaatccgtgtta
aacgatccggaaaagcggcaggagctgaacggccgaatgaatgaaacactctctgtccac
aaggatccgtggaaagactttttagaggataaacaaacctctaaagaattatttgaaaat
gtcgtgaccacatcataa

DBGET integrated database retrieval system