KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_02290Help
Entry
Q433_02290        CDS       T03469                                 

Definition
(GenBank) multidrug MFS transporter
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AIC97011
LinkDB All DBs
Position
complement(424011..425429)
Genome map
AA seq 472 aa AA seqDB search
MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFML
TNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMM
PLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVI
DLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSVGSYGWSSSTVLISLLVGV
IALLLFITRQMKLEKPMLEFRVFTFGIFSLTTLLGTLVFALLIGTETILPLYTQNVRDVT
AFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFCIIFLTSLPFMQLTDHTSLAW
IVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGGSIGTALLVSVMSN
QAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFTLKKPQRPAEQQPAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaagtattgaacaaaaaccttttaaccgttctgtcattgtcggcattttgtta
gccggagcgtttgtggcgattttgaaccagacattgttgattaccgcacttccccatatc
atgagggatttcaatgtcgatgccaaccaagcacaatggctgaccacatcatttatgtta
accaacgggattttaattccgattaccgcgtttttaattgagaaattcacaagccgggcg
ctgctcatcacagcaatgagcattttcactgccggaacagtcgtcggagcgttcgcgccg
aacttcccggttctgctgacagcgcgtatcattcaagcggccggagccggcattatgatg
ccgctcatgcagactgtattcctgacaatctttccgattgaaaaacgcggccaggctatg
ggtatggtcggattggtcatctcattcgcgcctgcgatcggaccgactctttccggatgg
gctgtcgaagctttctcttggagatcattgttttatattattcttccgtttgctgtgatt
gatttgattcttgccagcatcctgatgaaaaacgtgacgactttaagaaaaacacagatt
gatattttatcagtcatcctttcaacatttgggttcggcggccttctgtacggcttctca
agcgtcggctcttacggctggtccagttcaaccgtcttgatttcactgctggtgggtgtc
atcgcgctgctcttgtttatcacaagacaaatgaagcttgaaaaaccgatgctggaattc
cgcgtcttcacgtttggcattttcagtttaacaacactgctgggaaccctcgtctttgca
ttattgatcggtacggaaaccatcctgccgctttatacacaaaatgtcagagacgtcaca
gcttttgatacagggcttatgctccttccgggagccgttgtgatgggctttatgtcgccg
attatcggcagaatttttgaccgtgtcggcggaagagggctggcgattgccggtttctgc
atcatcttcctgacatctctgccgtttatgcagctgactgaccatacgtcactcgcttgg
attgtcgttttatacaccgttcgtctcttaggcaccgccatgatcatgatgccggtgaca
acagccggaatcaatgcgctgccgcgccacttgattccgcacggaactgcgatgaacaac
acgattcgccaagtcggcggctcgatcggaaccgcactattggtttccgtgatgagcaac
caggcggcacatgcaggcacgacaaatgtgaagcacgccgccctgcacggcatgaacgcc
gcttttatagtggctgccgtcattgcacttgtcggcttccttctctcattcacattaaag
aaacctcagcgccctgccgaacagcagccggcacgctga

DBGET integrated database retrieval system