KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_03500Help
Entry
Q433_03500        CDS       T03469                                 

Definition
(GenBank) hypothetical protein
  KO
K06872  uncharacterized protein
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Q433_03500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPM_phosphatase
Motif
Other DBs
NCBI-ProteinID: AIC97203
LinkDB All DBs
Position
625385..626149
Genome map
AA seq 254 aa AA seqDB search
MRGFFGKAIFVVLAVFIMMPLLGIEAARASESQQHVYDRAHLLSKAEIGKLESLSAELGA
KRDTDFIIITTKSTNGEDIADYTGDFYDRYGKGSTAILTIDMTNREVFIAGFKKAEQYLD
NSRLNSIRNTISSDLSNENYFKAFETYIQLSYKDMGIKPGVNPDNIFFTWWFQLIAAIAV
GGIAVSIMLYHAGGKVTVNGNTYMDQRTSDVIDQYDTYIRTTVTRERKPSDKDSGSDGGV
TKGGTSYSGSRGSF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggattttttgggaaagcgatctttgttgtgctggctgttttcatcatgatgcct
ttactgggtatcgaagcggcaagagcctctgaatcgcagcagcatgtgtacgatcgcgct
catctattgtcaaaagcggagatcggaaaacttgaatctctctcggcagagctgggtgca
aagagggacactgatttcatcattattacgaccaaaagcacaaacggtgaagatattgca
gactataccggcgatttttatgatcgttacggaaaaggcagcacagccattctgacgatt
gatatgacaaacagagaagtgtttatcgcaggcttcaaaaaagccgaacagtatttggac
aacagcaggctcaatagcatcagaaatacgatttcatctgatttatccaatgaaaattat
tttaaagcttttgagacatatattcagctttcctataaagatatgggcataaaaccggga
gtaaaccctgacaacatattctttacatggtggtttcagctgattgctgccatcgcagtc
gggggaattgcggtttcaatcatgctttatcatgcaggcggcaaagtaacggttaatgga
aatacatatatggatcagcgtacgtctgatgtgattgatcaatacgacacttatattaga
acgactgtaacaagagaaagaaaaccatcagataaagacagcggcagcgatggcggtgtt
acgaaaggcggcacgtcatacagtgggagccggggcagtttttaa

DBGET integrated database retrieval system