KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_03525Help
Entry
Q433_03525        CDS       T03469                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Q433_03525
Enzymes [BR:bsus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Q433_03525
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Q433_03525
    1.1.1.-  
     Q433_03525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AIC97207
LinkDB All DBs
Position
complement(630287..631327)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVDKPHPLT
NETAPVTMGHEFSGEVVEVGEGVENYKVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRSSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIAERTGGGVDVA
FEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPAV
LSLMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKSQVKILVRPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaagatggcataaccaaaaggatatccgtattgaacatatcgaagagcca
aaaacggagccgggaaaagtaaagatcaaagtcaaatggtgcggcatctgcggaagtgat
ttacacgaatatctgggcggcccgatctttattccggttgacaaaccgcacccattaaca
aatgaaacggcacctgtcacaatggggcatgaattctccggtgaagttgtcgaagtcgga
gaaggcgttgaaaattataaagttggagaccgcgtcgtagtcgagccgatttttgctaca
cacggccaccaaggcgcctacaaccttgatgaacaaatgggattcctcggcttagccggc
ggaggcggcggtttctctgaatacgtctctgtagatgaagagcttttgttcaaacttcct
gatgaattatcatatgaacaaggcgcgctcgttgaaccttctgcagttgctctatacgct
gtccgctcaagcaaactcaaagcaggcgacaaagcggctgtattcggctgcggcccgatc
ggacttcttgtcattgaagcgctgaaggctgccggtgcaactgatatttacgctgttgag
ctttctcctgaacgccagcaaaaagctgaggagcttggcgcgatcatcgtagatccgtct
aaaacagacgatgtagtcgctgagattgcagaacgtacaggaggcggtgttgacgtagca
ttcgaagtcactggtgtcccagtggtgttacgacaagccatccagtccactacaattgcc
ggtgaaaccgtcatcgtcagcatttgggaaaaaggtgctgaaatccatccgaacgatatc
gtaatcaaagaacgtacagtaaaaggaattatcggataccgcgacatcttcccggctgta
ttgtcattaatgaaagaaggctatttttcagccgacaaactcgtaacgaaaaaaatcgta
ctagatgatttgatcgaggaaggcttcggggctcttattaaagagaaaagccaagtcaaa
atccttgtcagacctaactaa

DBGET integrated database retrieval system