KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_03790Help
Entry
Q433_03790        CDS       T03469                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00970  Aminoacyl-tRNA biosynthesis
bsus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q433_03790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsus03029]
    Q433_03790
Enzymes [BR:bsus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Q433_03790
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Q433_03790
Mitochondrial biogenesis [BR:bsus03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Q433_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF3097 FIBP
Motif
Other DBs
NCBI-ProteinID: AIC97252
LinkDB All DBs
Position
682886..684316
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAM
KAAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVGGKTKRIGITR
LHLEEDAGKLTHTGDGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQYTGV
SDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQVLLSGG
VIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVKASIPELPDER
RKRYIEELGLPAYDAMVLTLTKEMADFFEETVQKGAEAKQASNWLMGEVSAYLNAEQKEL
ADVALTPEGLAGMIKLIEKGTISSKIAKKVFKELIEKGGDAEKIVKEKGLVQISDEGVLL
KLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKILLEEIKKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgaactttgaaacggtaatcggacttgaagtccacgttgagttaaaaacaaaatcaaaa
attttctcaagctctccaacgccattcggcgcggaggcgaatacgcagacaagcgttatt
gacctcggatatccgggcgtcctgcctgttctgaacaaagaagccgttgaattcgcaatg
aaagccgctatggcgctcaactgtgagatcgcaacggatacgaagtttgaccgcaaaaac
tatttctatcctgacaacccgaaagcgtatcagatttctcaatttgataagccaatcggc
gaaaacggctggatcgaaattgaagtcggcggaaaaacaaaacgcatcggcatcacgcgc
cttcaccttgaagaagatgccggaaaactgacacacacaggcgacggctattctcttgtt
gacttcaaccgccaaggaacgccgcttgttgagatcgtatcagagccggatatccgcacg
ccggaagaagcgtacgcgtatcttgaaaagctgaaatccatcatccagtatacaggcgtt
tctgactgtaaaatggaagaaggctcacttcgctgtgacgccaatatctctcttcgtccg
atcggccaagaggaattcggcacaaaaacagaattaaaaaacttgaactcctttgcgttt
gttcaaaaaggccttgagcatgaagaaaaacgccaggagcaggttcttctttccggcggc
gtcatccagcaagaaactcgccgttatgatgaagcaacgaagaaaaccattcttatgcgt
gtcaaagagggatctgacgactaccgttacttcccagagccggatctagtcgagctctac
attgatgatgaatggaaggaacgcgtaaaagcaagcattcctgagcttccggatgagcgc
cgcaagcgttatatcgaagagcttggcttgcctgcatatgacgcgatggttctgacgctg
acaaaagaaatggctgatttcttcgaagaaaccgttcaaaaaggcgctgaagccaaacaa
gcgtctaactggctgatgggtgaagtgtcagcttacctaaacgctgagcaaaaagagctt
gccgatgttgccctgacacctgaaggccttgccggcatgatcaaattgattgaaaaagga
accatttcttctaagatcgcgaagaaagtgtttaaagaattgattgaaaaaggcggcgac
gctgagaagattgtgaaagagaaaggccttgttcagatttctgacgaaggcgtgcttctg
aagcttgtcactgaggcgcttgacaacaatcctcaatcaatcgaagactttaaaaacgga
aaagaccgcgcgatcggcttcctagtcggacagattatgaaagcgtccaaaggacaagcc
aacccgccgatggtcaacaaaattctgcttgaagaaattaaaaaacgctaa

DBGET integrated database retrieval system