KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_13695Help
Entry
Q433_13695        CDS       T03469                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Brite
Enzymes [BR:bsus01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Q433_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIC98890
LinkDB All DBs
Structure
PDB: 

Position
complement(2439313..2439924)
Genome map
AA seq 203 aa AA seqDB search
MMAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVA
DLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQF
AAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP
DYISAFWNVVNWDEVARLYSEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atcatggcttacgaacttccagaattaccttatgcgtacgatgctttagaaccgcatatc
gacaaggaaactatgactattcaccatacgaaacaccacaacacatacgtgacaaattta
aacaaagcggttgaaggaaacactgctcttgccaacaaatcagttgaagagcttgttgca
gatcttgattctgttcctgaaaacatccgcactgcagtccgcaacaacggcggcggacac
gcgaaccacaaattattctggacacttttatctccaaacggcggaggcgaaccgactggc
gcgcttgctgaagagattaacagtgtatttggaagctttgacaaattcaaagagcaattc
gcagcagcagcagctggacgcttcggttctggctgggcatggcttgttgtgaacaacggt
aaacttgaaatcacaagcacgccaaaccaagattctccgctttcagaaggcaaaacgcct
atcttaggtcttgacgtttgggagcatgcttactaccttaactatcaaaaccgccgtcct
gattacatttcagctttctggaatgttgtaaactgggacgaagtggctcgtctatacagc
gaagcaaaataa

DBGET integrated database retrieval system