KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_15780Help
Entry
Q433_15780        CDS       T03469                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00020  Citrate cycle (TCA cycle)
bsus00480  Glutathione metabolism
bsus01100  Metabolic pathways
bsus01110  Biosynthesis of secondary metabolites
bsus01120  Microbial metabolism in diverse environments
bsus01130  Biosynthesis of antibiotics
bsus01200  Carbon metabolism
bsus01210  2-Oxocarboxylic acid metabolism
bsus01230  Biosynthesis of amino acids
Module
bsus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsus_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q433_15780
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Q433_15780
Enzymes [BR:bsus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Q433_15780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIC99227
LinkDB All DBs
Structure
PDB: 

Position
complement(2792693..2793964)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtctctaacggagtattaaacgtaccaaacaacccg
attatcccatttatcgaaggagacggaaccggtcctgatatttggaacgcggcttcgaag
gttttggaagcagcagtagaaaaagcatacaaaggcgaaaagaaaattacatggaaagaa
gtttacgccggagaaaaggcttataataaaacaggtgagtggctccctgctgaaacatta
gatgtgatccgcgaatatttcatcgcgattaaaggcccgttaacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtatgcaaaaggctct
gaagaagtgcaaaagcttatcagcttccttcaaaatgagttaaacgtcaataaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttcagaagaaggaacaagccgcttg
gtcagagctgccattgattatgcgatcgagcatggccgcaaatctgtaacacttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaattggggctatgaacttgct
gaaaaagaatacggagataaagtctttacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagatgctgccaacaaagcgcaaagcgaagcggaagcagcaggaaaaatcatt
atcaaagacagcattgctgacattttccttcagcagatcttaacgcgtccaaacgagttt
gatgtcgttgcgacaatgaacttgaacggagattacatttctgatgctcttgctgcgcaa
gtcggcggaatcggcattgctcctggagcgaacatcaactacgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttaggatggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttccaaagtcgtaacttacgattttgct
agattaatggacggggcgactgaagtgaaatgttcagagttcggagaagaactgatcaaa
aacatggactaa

DBGET integrated database retrieval system