KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_17690Help
Entry
Q433_17690        CDS       T03469                                 

Definition
(GenBank) lipoyl synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00785  Lipoic acid metabolism
bsus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Q433_17690
Enzymes [BR:bsus01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Q433_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: AIC99534
LinkDB All DBs
Position
complement(3133352..3134248)
Genome map
AA seq 298 aa AA seqDB search
MAKKDEHLRKPEWLKIKLNTNENYTGLKKLMRENNLHTVCEEAKCPNIHECWAVRRTATF
MILGSVCTRACRFCAVKTGLPTELDLQEPERVADSVALMNLKHAVITAVARDDQKDGGAG
IFAETVRAIRRKSPFTTIEVLPSDMGGNYDNLKTLMDTRPDILNHNIETVRRLTPRVRAR
ATYDRSLEFLRRAKEMQPDIPTKSSIMIGLGETKEEIIEVMDDLLANNVDIMAIGQYLQP
TKKHLKVQKYYHPDEFAELKEIAMQKGFSHCEAGPLVRSSYHADEQVNEASKKRQAQA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagaaagacgaacacctcagaaagcccgaatggcttaaaattaaattaaataca
aatgaaaactatacagggctcaaaaaactcatgcgggaaaacaaccttcataccgtatgc
gaagaagcaaaatgtccgaatattcatgaatgctgggctgtcagacgtacagcgacattt
atgattttaggttctgtttgtacaagagcatgccgtttctgtgctgtcaaaacaggcctt
ccaactgagcttgacctgcaagagccggaacgcgtagcggattcagtcgcgcttatgaat
ttgaagcacgcggttattacggctgttgcgcgtgatgatcagaaagatggaggggcaggc
attttcgcggaaactgtccgtgcgatccgcagaaaaagcccgttcacaacaattgaggtg
ctgccgtctgatatgggcggaaactatgataacctaaaaaccttgatggatacacgccca
gacatcctgaatcacaatatcgaaacggttcgccgcctgacgccaagagtccgcgcgcgt
gcgacgtacgaccgttcattggaatttttgcgccgtgcgaaggaaatgcagcctgacatt
ccgacaaaatcaagtatcatgatcgggctcggcgaaacaaaagaagagattattgaagta
atggacgacctcttggcgaacaacgtggatattatggcaatcggccaatatctgcagccg
acgaagaaacacttgaaagtccaaaaatactaccatcctgatgaatttgcagaattaaaa
gaaatcgcgatgcaaaaaggcttcagccattgtgaagccggtccgcttgtccgttcctct
taccatgcggatgaacaagtaaacgaagcatctaaaaagcgtcaagcccaagcataa

DBGET integrated database retrieval system