KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_18035Help
Entry
Q433_18035        CDS       T03469                                 

Definition
(GenBank) hypothetical protein
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF3106
Motif
Other DBs
NCBI-ProteinID: AIC99596
LinkDB All DBs
Position
complement(3191820..3192065)
Genome map
AA seq 81 aa AA seqDB search
MEQKLQEQLDGLLEKYTELLLGETNDELKEEVKQWILYTHIAKSMPPLAKHWNATYPDAK
QGIKEIIQHIKELNEAQRNKQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaacttcaggagcagcttgatggattgctggagaagtatactgagcttctg
cttggtgaaacaaacgatgagctaaaagaagaagtgaagcaatggattttgtacacccat
atagccaaaagcatgcctccgctcgctaagcattggaatgcgacataccccgacgcgaag
cagggcattaaagagatcattcagcatattaaggaattaaatgaagcgcaacgaaacaaa
caatag

DBGET integrated database retrieval system