KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_00084Help
Entry
BSUB_00084        CDS       T03442                                 

Gene name
hslO
Definition
(GenBank) heat shock protein 33
  KO
K04083  molecular chaperone Hsp33
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsut03110]
    BSUB_00084 (hslO)
Chaperones and folding catalysts [BR:bsut03110]
 Heat shock proteins
  HSP33
   BSUB_00084 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIC42678
LinkDB All DBs
Structure
PDB: 

Position
79880..80755
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgcagcgaga
acgactgatatggtaaatgaggggcagagacgccatggtacgtggccgacagcatccgct
gcactaggccgtacaatgacagcttcacttatgctcggcgctatgctgaagggcgatgat
aagctgaccgtgaaaatcgagggcggaggtccgatcggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccgcaagttcattttgatttaaatgaa
caaggtaagcttgatgtcagacgtgcggttggaacaaacggaacgttaagtgtcgtaaaa
gatttaggtttgcgcgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgattttacttactatcttgtgtcatctgagcaggttccttcatcagtgggcgtaggt
gtgctcgtaaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaacaatcacaaaaattgaacagcgtctatctcaagtagagccg
atttctaagctcatccaaaaagggctgacaccagaagaaattttagaagaagtcctaggc
gagaaacctgagattttggaaacgatgcctgtcagattccattgcccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system