KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_00395Help
Entry
BSUB_00395        CDS       T03442                                 

Gene name
hxlB
Definition
(GenBank) 6-phospho 3-hexuloisomerase
  KO
K08094  6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
bsut00030  Pentose phosphate pathway
bsut00680  Methane metabolism
bsut01100  Metabolic pathways
bsut01120  Microbial metabolism in diverse environments
bsut01200  Carbon metabolism
bsut01230  Biosynthesis of amino acids
Module
bsut_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSUB_00395 (hxlB)
  09102 Energy metabolism
   00680 Methane metabolism
    BSUB_00395 (hxlB)
Enzymes [BR:bsut01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     BSUB_00395 (hxlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 Transglut_core
Motif
Other DBs
NCBI-ProteinID: AIC42954
LinkDB All DBs
Structure
PDB: 

Position
complement(374599..375156)
Genome map
AA seq 185 aa AA seqDB search
MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMH
MGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIG
KQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVILKLMEKKGLDSETMFTH
HANLE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactgaatacgtagcggaaattctcaatgagttacacaattcagcagcttat
atttctaatgaagaagctgaccagcttgccgatcacattctttcatcccaccaaattttc
accgcgggtgcggggcggtctggcctgatggcaaaatccttcgcgatgagactgatgcac
atgggcttcaacgcccatatagtaggtgagattctcactccgccgctcgccgaaggagat
ctagttattatcggctcaggatcaggcgagacaaagagcttgattcataccgcagcaaaa
gcaaaaagcttacacggaattgttgccgctttaaccatcaatccggaatcaagcatcgga
aaacaagcggacctcatcatcagaatgcctggttcccctaaagaccagtctaacggaagc
tataaaaccattcagccaatgggatcattatttgaacaaactttgctgctcttctatgat
gcagtgattttaaaactcatggagaaaaaaggtctcgattctgaaactatgttcactcac
cacgcaaaccttgaatag

DBGET integrated database retrieval system