KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_01139Help
Entry
BSUB_01139        CDS       T03442                                 

Gene name
comK
Definition
(GenBank) competence transcription factor (CTF)
  KO
K02250  competence protein ComK
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
bsut02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSUB_01139 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsut03000]
    BSUB_01139 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsut02044]
    BSUB_01139 (comK)
Transcription factors [BR:bsut03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSUB_01139 (comK)
Secretion system [BR:bsut02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSUB_01139 (comK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK V-set
Motif
Other DBs
NCBI-ProteinID: AIC43660
LinkDB All DBs
Position
1100657..1101235
Genome map
AA seq 192 aa AA seqDB search
MSQKTDAPLESYEVNGATIAVLPEEIDGKICSKIIEKDCVFYVNMKPLQIVDRSCRFFGS
SYAGRKAGTYEVTKISHKPPIMVDPSNQIFLFPTLSSTRPQCGWISHVHVKEFKATEFDD
TEVTFSNGKTMELPISYNSFENQVYRTAWLRTKFQDRIDHRVPKRQEFMLYPKEERTKMI
YDFILRELGERY
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaaaacagacgcacctttagaatcgtatgaagtgaacggcgcaacaattgcc
gtgctgccagaagaaatagacggcaaaatctgttccaaaattattgaaaaagattgcgtg
ttttatgtaaacatgaagccgctgcaaattgtcgacagaagctgccgattttttggatca
agctatgcgggaagaaaagcaggaacttatgaagtgacaaaaatttcacacaagccgccg
atcatggtggacccttcgaaccaaatctttttattccctacactttcttcgacaagaccc
caatgcggctggatttcccatgtgcatgtaaaagaattcaaagcgactgaattcgacgat
acggaagtgacgttttccaatgggaaaacgatggagctgccgatctcttataattcgttc
gagaaccaggtataccgaacagcgtggctcagaaccaaattccaagacagaatcgaccac
cgcgtgccgaaaagacaggaatttatgctgtacccgaaagaagagcggacgaagatgatt
tatgattttattttgcgtgagctcggggaacggtattag

DBGET integrated database retrieval system