KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02167
Entry
BSUB_02167        CDS       T03442                                 
Name
(GenBank) yosJ
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: AIC44679
LinkDB
Position
complement(2139426..2139620)
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system