KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02315Help
Entry
BSUB_02315        CDS       T03442                                 

Gene name
yolC
Definition
(GenBank) SP beta phage protein
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4252 Docking
Motif
Other DBs
NCBI-ProteinID: AIC44827
LinkDB All DBs
Position
2244924..2245259
Genome map
AA seq 111 aa AA seqDB search
MKKRLIGFLVLVPALIMSGITLIEANKKSPLEVIDNIRDEFGIFSVQIGQTDPAITIGMD
QTKSEAKLREYLKDNLSREAKEKYKIYILKDDINKLEKEHREYLKANNPNK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaggctaatcggatttttggtcttagttcctgctttgattatgtcaggtatt
actttaatcgaagcaaataaaaagtcccctttggaagtaattgataatattcgggatgaa
tttggtatattcagtgtgcaaattggtcaaacagatccggcaattacaattggcatggat
caaaccaaaagtgaagcaaagctccgtgagtatttaaaagataatctgtctagagaagca
aaggaaaaatataagatctatatattaaaagatgatattaataaattggagaaagaacat
cgagagtatttgaaagcaaataaccccaataagtaa

DBGET integrated database retrieval system